Entry information : SmGPx04-2_61 (SmGPx04b_61)
Entry ID 7409
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmGPx04-2_61 (SmGPx04b_61)
Name (synonym) SmGPx04-2_61 (SmGPx04b_61)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2009]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmGPx04-2_61
start..stop
S start..stop
SmGPx04-1_19 372 5e-134 1..196 1..196
SmGPx02-2_57 184 3e-60 17..172 7..166
SmGPx02-1_0 183 7e-60 17..172 7..166
HbGPx02 181 7e-59 16..173 5..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 601996..602073 78 N° 2 602130..602206 77 N° 3 602265..602326 62 N° 4 602400..602518 119
N° 5 602596..602754 159 N° 6 602805..602900 96  
join(601996..602073,602130..602206,602265..602326,602400..602518,602596..602754, 602805..602900)


exon

Literature and cross-references SmGPx04-2_61 (SmGPx04b_61)
DNA ref. Phytozome 11:   scaffold_61 (601996..602900)
mRNA ref. JGI transcript:   119990
Protein sequence: SmGPx04-2_61 (SmGPx04b_61)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   22510.28  
PI (pH):   %s   4.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGDEEIVNMREPDYTPASIYEIDVRDKHGQKVSMSKYRDKGLLIVNVATMSAFASSMYKELNELHVKYVDGLEILAFPCNQFAAQEPLRTEYLQETVSSRFGPHFPLFEVDVNGPNTAVLFRYLKDKSDGDRIRWNFTKFLINRTGGIAGRYAPHIPPYKLEEDIKSLLAVELPFEEEKRKNAPEEEEQEEEP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGCGACGAAGAGATCGTGAACATGAGGGAGCCGGACTATACTCCCGCCAGCATCTATGAGATCGATGTTAGGGTATTCTTCCTCCATCCAACTCGCGTTTGTTTTCATAGATCG
ATTGGTGATCACAGGACAAACACGGCCAAAAAGTTTCCATGAGCAAATACAGAGACAAGGGTCTTTTGATCGTCAATGTCGCCACAATGTCGTGCGTATCTCCTGTTCTCGATTGATTGC
ATTTTCCATTCCTCATATGATCCATCCAGGGCGTTTGCTTCAAGCATGTACAAGGAGCTCAACGAGCTCCACGTAAAATACGTGGACGAAGGTTCTTTTGATCTTGTGTTTCTTTCTCTG
GGATCCTCCAAACTATAGCTTCGATTGCAGTCGTGATTCGCCAGGGCTAGAGATTTTGGCATTCCCGTGCAACCAATTCGCTGCGCAAGAGCCACTCAGGACGGAATATCTTCAAGAGAC
AGTCTCTTCTCGATTTGGGCCACACTTCCCACTCTTTGAAAGG
GTACGAGAGATTTCTCACTGAGAATAGGATCCAATTCGAACACTTGATCGAGAATTTTGACGATGTTTGATCCACAG

GTGGATGTAAATGGCCCAAACACCGCAGTTCTCTTCAGGTACCTCAAGGACAAGAGCGATGGCGATCGAATTCGCTGGAATTTCACAAAGTTTTTGATCAATCGAACTGGTGGAATTGCT
GGGAGATACGCCCCTCACATACCACCATACAAATTGGAG
GTTGGTTCTTCCCATTCTAGCATTTCTTCATCAATTTTCTTTGACATCAGGAAGATATCAAGAGCCTCTTGGCTGTGGAGC
TCCCATTTGAGGAAGAAAAGAGAAAGAATGCCCCCGAGGAAGAAGAACAGGAGGAAGAACCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGGCGACGAAGAGATCGTGAACATGAGGGAGCCGGACTATACTCCCGCCAGCATCTATGAGATCGATGTTAGGGACAAACACGGCCAAAAAGTTTCCATGAGCAAATACAGAGAC
AAGGGTCTTTTGATCGTCAATGTCGCCACAATGTC
GGCGTTTGCTTCAAGCATGTACAAGGAGCTCAACGAGCTCCACGTAAAATACGTGGACGAAGGGCTAGAGATTTTGGCATTCCCG
TGCAACCAATTCGCTGCGCAAGAGCCACTCAGGACGGAATATCTTCAAGAGACAGTCTCTTCTCGATTTGGGCCACACTTCCCACTCTTTGAAAGG
GTGGATGTAAATGGCCCAAACACC
GCAGTTCTCTTCAGGTACCTCAAGGACAAGAGCGATGGCGATCGAATTCGCTGGAATTTCACAAAGTTTTTGATCAATCGAACTGGTGGAATTGCTGGGAGATACGCCCCTCACATACCA
CCATACAAATTGGAG
GAAGATATCAAGAGCCTCTTGGCTGTGGAGCTCCCATTTGAGGAAGAAAAGAGAAAGAATGCCCCCGAGGAAGAAGAACAGGAGGAAGAACCCTAA

Retrieve as FASTA