Entry information : ZmPrx45
Entry ID 741
Creation 2005-06-13 (Christophe Dunand)
Last sequence changes 2005-06-13 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx45
Name ZmPrx45
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx45
start..stop
S start..stop
SbPrx88 600 0 4..345 3..341
SiPrx110 570 0 6..345 4..339
BdiPrx118 524 0 22..345 12..331
OsPrx133 509 0 34..345 27..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13946794..13947237 444 N° 2 13947352..13947514 163 N° 3 13947620..13948050 431  
join(13946794..13947237,13947352..13947514,13947620..13948050)


exon

Literature and cross-references ZmPrx45
Literature Walbot,V., unpublished
DNA ref. GenBank:   AC209935.4 (61721..60468)
Protein sequence: ZmPrx45
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (309)
PWM (Da):   %s   36125.27 (32663.4) Transmb domain:   %s   i12-34o
PI (pH):   %s   5.73 (5.15) Peptide Signal:   %s   cut: 37 range:37-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGTTRCSIRGSNAPGLALPCLLLLLLLAGAGVSNGQLQVGFYSKSCPDAESTVASVVRQSGSADPTILPALIRLQFHDCFVRGCDGSVLIKGGGNNNNNAEVDNGKHQGLRGLEIIEGAKTQLEAQCPGVVSCADIVVLAARDAVAFTGGPSFDVPTGRLDGKVSNLRDADALPDVHDGIDALRSKFRANGLDEKDLVLLTAAHTVGTTACFFLQDRLYNFPLPGGGRGSDPTIPPGFLSELKARCAPGDFNTRLALDRGSENVFDTSILRNIRNGFAVIGTDAALYNDTATVDVVDSYSGLLSNFFGPYFRQDFADAMVRMGSVGVVTGSKQGEVRKVCSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 2 and 3) and 40 + 33 ESTs. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGCACCACAAGGTGTAGTATCAGAGGCAGCAACGCTCCCGGCTTGGCCCTGCCATGCTTGCTGCTGCTGCTGCTGCTCGCGGGCGCAGGCGTCTCCAACGGCCAGCTCCAGGTG
GGGTTCTACTCCAAGTCCTGCCCGGACGCCGAGTCCACCGTGGCGTCCGTCGTCCGGCAGTCCGGGTCCGCCGACCCCACCATCCTCCCGGCGCTCATCCGGCTCCAGTTCCACGACTGC
TTCGTCCGCGGCTGCGACGGGTCGGTGCTCATCAAGGGCGGCGGCAACAACAACAACAACGCCGAGGTGGACAACGGCAAGCACCAGGGCCTCCGCGGCCTGGAGATCATCGAGGGCGCC
AAGACGCAGCTCGAGGCGCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGTGCTCGCTGCCCGAGACGCCGTCGCCTTC
GTACGTTTGCGCATGATGTGTGTAATATGTCACGTT
GATATATAACTGGCCGGGATCTGACCGACGTGAACACGTACGCGCGCGTGACGTACGATGGCGTACGTGTATATGCAGACCGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGGCTCGAC
GGGAAGGTGTCCAACCTGCGGGACGCCGACGCGCTGCCGGACGTGCACGACGGCATCGACGCGCTCCGCTCCAAGTTCCGCGCCAACGGCCTTGACGAGAAGGACCTCGTCCTCCTCACC
G
GTACGCATGCTGCATGCATCTCCTGTCTCTCTAGCTAATTAGCTAATTAGCTAGGTACGTACCTAGCTGACCCACGCCATTGCGCCGACACATGCATGCACGCAGCTGCGCACACGGTG
GGCACGACGGCGTGCTTCTTCCTCCAGGACCGGCTCTACAACTTCCCGCTGCCGGGCGGCGGGCGGGGCTCGGACCCGACCATCCCGCCGGGCTTCCTGTCGGAGCTCAAGGCCCGGTGC
GCGCCGGGGGACTTCAACACGCGCCTGGCCCTGGACCGCGGCAGCGAGAACGTCTTCGACACCTCCATCCTCCGCAACATCCGCAACGGCTTCGCCGTCATCGGCACCGACGCCGCGCTC
TACAACGACACGGCCACGGTCGACGTCGTCGACTCCTACTCCGGCCTGCTCAGCAACTTCTTCGGGCCCTACTTCCGGCAGGACTTCGCGGACGCCATGGTCCGCATGGGCAGCGTCGGC
GTGGTCACCGGCAGCAAGCAGGGCGAGGTCCGGAAGGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGGCACCACAAGGTGTAGTATCAGAGGCAGCAACGCTCCCGGCTTGGCCCTGCCATGCTTGCTGCTGCTGCTGCTGCTCGCGGGCGCAGGCGTCTCCAACGGCCAGCTCCAGGTG
GGGTTCTACTCCAAGTCCTGCCCGGACGCCGAGTCCACCGTGGCGTCCGTCGTCCGGCAGTCCGGGTCCGCCGACCCCACCATCCTCCCGGCGCTCATCCGGCTCCAGTTCCACGACTGC
TTCGTCCGCGGCTGCGACGGGTCGGTGCTCATCAAGGGCGGCGGCAACAACAACAACAACGCCGAGGTGGACAACGGCAAGCACCAGGGCCTCCGCGGCCTGGAGATCATCGAGGGCGCC
AAGACGCAGCTCGAGGCGCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGTGCTCGCTGCCCGAGACGCCGTCGCCTTC
ACCGGCGGGCCGTCGTTCGACGTGCCCACGGGGCGG
CTCGACGGGAAGGTGTCCAACCTGCGGGACGCCGACGCGCTGCCGGACGTGCACGACGGCATCGACGCGCTCCGCTCCAAGTTCCGCGCCAACGGCCTTGACGAGAAGGACCTCGTCCTC
CTCACCG
CTGCGCACACGGTGGGCACGACGGCGTGCTTCTTCCTCCAGGACCGGCTCTACAACTTCCCGCTGCCGGGCGGCGGGCGGGGCTCGGACCCGACCATCCCGCCGGGCTTCCTG
TCGGAGCTCAAGGCCCGGTGCGCGCCGGGGGACTTCAACACGCGCCTGGCCCTGGACCGCGGCAGCGAGAACGTCTTCGACACCTCCATCCTCCGCAACATCCGCAACGGCTTCGCCGTC
ATCGGCACCGACGCCGCGCTCTACAACGACACGGCCACGGTCGACGTCGTCGACTCCTACTCCGGCCTGCTCAGCAACTTCTTCGGGCCCTACTTCCGGCAGGACTTCGCGGACGCCATG
GTCCGCATGGGCAGCGTCGGCGTGGTCACCGGCAGCAAGCAGGGCGAGGTCCGGAAGGTCTGCTCCAAGTTCAACTGA

Retrieve as FASTA