Entry information : SmDiOx-1_0 (SmDiOxa_0)
Entry ID 7410
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmDiOx-1_0 (SmDiOxa_0)
Name (synonym) SmDiOx-1_0 (SmDiOxa_0)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmDiOx-1_0
start..stop
S start..stop
SmDiOx-2_8 1155 0 1..574 1..571
PabDiOx01 711 0 42..574 97..623
CclDiOx02 702 0 7..574 62..623
PsDiOx01 694 0 48..572 107..625
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3393093..3393209 117 N° 2 3393286..3393378 93 N° 3 3393432..3393590 159 N° 4 3393652..3393785 134
N° 5 3393832..3394045 214 N° 6 3394102..3394247 146 N° 7 3394313..3394549 237 N° 8 3394614..3394816 203
N° 9 3394888..3395131 244 N° 10 3395188..3395365 178  
join(3393093..3393209,3393286..3393378,3393432..3393590,3393652..3393785,3393832 ..3394045,3394102..3394247,3394313..3394549,3394614..3394816,3394888..3395131,33 95188..3395365)


exon

Literature and cross-references SmDiOx-1_0 (SmDiOxa_0)
DNA ref. Phytozome 12:   scaffold_0 (3393093..3395364)
mRNA ref. JGI transcript:   229898 [Incorrect prediction]
Protein sequence: SmDiOx-1_0 (SmDiOxa_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   574
PWM (Da):   %s   64349.08  
PI (pH):   %s   7.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPDRPFRRQTHGVAQAPACVLAVLSRHPEDTPPKLQLEKKSSGEHVNVKSGDYGSFIGRNAFAPASGSEELLDPHPSVVATKFLSRKESEFADTGKQFNMIAASWIQFMIHDWVDHQEDTKEQEIVAPESVAAQCPLKEFRFLRTKEDETGSQDIPLGHRNMRTSWWDGSVLYGSHDGALARVRTGKDGKLKIGQNGLLERDDHGVAISGDVKNTWAGVSILQALFVKEHNAVCDMLKRTHPEFGDEELYLHARLVVAAVIAKIHTIDWTVELLKTKALDIGMHANWYGLLGKRIKSWIGHTGSSLLSGFIGMKEPINHGVPYALTEEFTCVYRLHPLLPDDIVLRDITGSGEEKQTKTPRATGKRIPMIELIGSEGEKTLVAxGNERMIASLGHQACGALVLFNYPQWMRDLPQTGTDGINRPNHVDMAALEIYRDRERKVARYNAFRRNMLMIPIKKWEDLTDDKQTLALLREVYGEDVEKLDLLVGLLAEKKIKGFAISETSFFIFLLMATRRLEADRFFTSNFNAKSYTKEGLAWVNNTESLKDVLQRHHGNLVDKWLNARSAFSVWSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCAGATCGTCCATTTCGTCGACAAACACACGGCGTGGCACAAGCTCCCGCTTGTGTTCTCGCTGTTTTATCTCGACATCCGGAGGACACTCCACCAAAACTACAACTTGAAGTA
CGTCGGACCTCCAATCTCAGAAGAAGAGAAAAAAGCCGCGCAGGATGACTGCATAGCTCCGCCTTTCCGGAAGAAAAAATCCAGTGGCGAGCACGTCAATGTCAAAAGTGGCGACTATGG
ATCATTCATTGGGAGAAATGCCTTTGCTCCAGCATCCGGATCCGAG
GTCTCTCTTCTCTCTCTCTCTCTCTCTCATGAGATTCGATTTGCGTCGAGCAGGAACTTTTGGATCCACATCCC
AGTGTTGTGGCGACCAAATTTCTGTCGAGAAAGGAATCCGAATTCGCGGACACGGGCAAGCAGTTCAACATGATCGCGGCGTCCTGGATCCAGTTTATGATCCACGACTGGGTCGACCAC
CAGGAAGACACAAAAGAG
GTATGATTCGTGTGATCGAAGCCAAGGATTCTTCTCACGGATGATTTTGTTTTCGATCCAGCAAGAGATTGTAGCTCCGGAATCAGTCGCAGCGCAGTGTCC
CTTGAAGGAATTTCGGTTCCTCCGCACGAAAGAGGACGAAACGGGCTCGCAAGACATCCCTTTGGGGCATAGGAACATGAGAACATCGTGGTG
GTATGAAACTCTTGTAATTGGAGGGAA
GTTTCATTTTACATTTTAGGGATGGGAGTGTTCTATACGGGAGCCACGACGGTGCGCTGGCGAGGGTGCGCACTGGCAAAGATGGAAAACTTAAGATCGGCCAAAATGGCCTCCTTGAGC
GCGACGATCACGGCGTCGCCATCTCCGGCGATGTCAAGAACACCTGGGCCGGGGTTTCGATTCTCCAGGCGCTTTTCGTCAAGGAGCACAATGCCGTGTGTGACATGCTCAAG
GTGCGTG
TGCCTCGATCGATCTCTAGCTCTGGATTGCCGCTAAATCGTCGCTCCAGAGGACGCATCCGGAATTCGGGGACGAAGAGCTCTACCTTCATGCGAGATTGGTCGTCGCTGCCGTGATTGC
CAAGATTCACACCATCGACTGGACTGTGGAGCTGCTCAAGACGAAAGCGCTCGACATTGGAATGCATGCAAACTG
GTGAGCTTTTCTTCTTTACGTCCACCTTTTCTAGCGATTTCGACT
GACTTCGAGAGTGCATCCAGGTATGGTTTACTGGGGAAGAGAATCAAGAGCTGGATCGGGCACACTGGATCCTCGCTGCTGAGTGGATTTATTGGAATGAAGGAGCCAATAAACCACGGC
GTTCCTTACGCCTTGACGGAGGAGTTTACGTGCGTTTATCGCCTCCATCCTTTGCTACCAGACGACATTGTGCTGAGAGACATCACTGGCAGTGGGGAAGAGAAACAAACCAAGACTCCT
CGAGCCACTGGAAAGAG
GTACCTCCATCTCTTTTTTTTTAATTTTACCACTCCTGACTAAACTTTTTCTTGTGATCTATAGAATTCCCATGATCGAGCTCATTGGAAGTGAGGGAGAAAA
AACGCTGGTAGCATTNGGAAACGAGAGAATGATCGCGTCGCTTGGGCATCAAGCTTGTGGAGCGCTCGTTCTTTTCAACTATCCGCAGTGGATGAGGGACCTTCCCCAGACTGGAACCGA
CGGCATAAACCGCCCGAATCACGTCGACATGGCCGCCCTCGAGA
GTAAGTTCTGTTCTTGCCAGACGCTTGTTTTCCTCGATCTTATCTTTGCATCTCTGCACTTTTTGTCCCAGTTTAC
CGTGATCGCGAAAGAAAAGTTGCAAGATACAATGCCTTTCGGAGAAACATGTTGATGATTCCAATCAAGAAGTGGGAGGATCTCACCGATGACAAACAAACACTCGCCTTGCTGAGGGAG
GTATACGGCGAGGACGTGGAGAAGCTCGACTTGCTCGTCGGCTTGCTGGCGGAGAAGAAGATCAAAGGCTTCGCCATTAGCGAGACGTCGTTTTTCATCTTTCTCCTCATGGCCACCAG
G
TAAAAACTGCTAGAACCAAGTCACAGTTTTAACACATTGCATTGCTTTCCCACAGGAGGCTAGAAGCTGATCGATTCTTTACCTCAAACTTTAACGCCAAGAGCTACACCAAGGAGGGAC
TGGCGTGGGTGAACAACACCGAGAGCCTCAAAGACGTCCTCCAGAGGCACCACGGCAACTTGGTTGATAAGTGGCTAAACGCACGCAGCGCATTCAGCGTGTGGAGTGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCAGATCGTCCATTTCGTCGACAAACACACGGCGTGGCACAAGCTCCCGCTTGTGTTCTCGCTGTTTTATCTCGACATCCGGAGGACACTCCACCAAAACTACAACTTGAAAAA
AAATCCAGTGGCGAGCACGTCAATGTCAAAAGTGGCGACTATGGATCATTCATTGGGAGAAATGCCTTTGCTCCAGCATCCGGATCCGAG
GAACTTTTGGATCCACATCCCAGTGTTGTG
GCGACCAAATTTCTGTCGAGAAAGGAATCCGAATTCGCGGACACGGGCAAGCAGTTCAACATGATCGCGGCGTCCTGGATCCAGTTTATGATCCACGACTGGGTCGACCACCAGGAAGAC
ACAAAAGAG
CAAGAGATTGTAGCTCCGGAATCAGTCGCAGCGCAGTGTCCCTTGAAGGAATTTCGGTTCCTCCGCACGAAAGAGGACGAAACGGGCTCGCAAGACATCCCTTTGGGGCAT
AGGAACATGAGAACATCGTGGTG
GGATGGGAGTGTTCTATACGGGAGCCACGACGGTGCGCTGGCGAGGGTGCGCACTGGCAAAGATGGAAAACTTAAGATCGGCCAAAATGGCCTCCTT
GAGCGCGACGATCACGGCGTCGCCATCTCCGGCGATGTCAAGAACACCTGGGCCGGGGTTTCGATTCTCCAGGCGCTTTTCGTCAAGGAGCACAATGCCGTGTGTGACATGCTCAAG
AGG
ACGCATCCGGAATTCGGGGACGAAGAGCTCTACCTTCATGCGAGATTGGTCGTCGCTGCCGTGATTGCCAAGATTCACACCATCGACTGGACTGTGGAGCTGCTCAAGACGAAAGCGCTC
GACATTGGAATGCATGCAAACTG
GTATGGTTTACTGGGGAAGAGAATCAAGAGCTGGATCGGGCACACTGGATCCTCGCTGCTGAGTGGATTTATTGGAATGAAGGAGCCAATAAACCAC
GGCGTTCCTTACGCCTTGACGGAGGAGTTTACGTGCGTTTATCGCCTCCATCCTTTGCTACCAGACGACATTGTGCTGAGAGACATCACTGGCAGTGGGGAAGAGAAACAAACCAAGACT
CCTCGAGCCACTGGAAAGAG
AATTCCCATGATCGAGCTCATTGGAAGTGAGGGAGAAAAAACGCTGGTAGCATTNGGAAACGAGAGAATGATCGCGTCGCTTGGGCATCAAGCTTGTGGA
GCGCTCGTTCTTTTCAACTATCCGCAGTGGATGAGGGACCTTCCCCAGACTGGAACCGACGGCATAAACCGCCCGAATCACGTCGACATGGCCGCCCTCGAGA
TTTACCGTGATCGCGAA
AGAAAAGTTGCAAGATACAATGCCTTTCGGAGAAACATGTTGATGATTCCAATCAAGAAGTGGGAGGATCTCACCGATGACAAACAAACACTCGCCTTGCTGAGGGAGGTATACGGCGAG
GACGTGGAGAAGCTCGACTTGCTCGTCGGCTTGCTGGCGGAGAAGAAGATCAAAGGCTTCGCCATTAGCGAGACGTCGTTTTTCATCTTTCTCCTCATGGCCACCAG
GAGGCTAGAAGCT
GATCGATTCTTTACCTCAAACTTTAACGCCAAGAGCTACACCAAGGAGGGACTGGCGTGGGTGAACAACACCGAGAGCCTCAAAGACGTCCTCCAGAGGCACCACGGCAACTTGGTTGAT
AAGTGGCTAAACGCACGCAGCGCATTCAGCGTGTGGAGTGCGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCAG ATCGTCCATT TCGTCGACAA ACACACGGCG TGGCACAAGC TCCCGCTTGT GTTCTCGCTG TTTTATCTCG ACATCCGGAG GACACTCCAC CAAAACTACA ACTTGAAAAA  AAATCCAGTG GCGAGCACGT CAATGTCAAA AGTGGCGACT ATGGATCATT CATTGGGAGA AATGCCTTTG CTCCAGCATC CGGATCCGAG GAACTTTTGG ATCCACATCC CAGTGTTGTG  GCGACCAAAT TTCTGTCGAG AAAGGAATCC GAATTCGCGG ACACGGGCAA GCAGTTCAAC ATGATCGCGG CGTCCTGGAT CCAGTTTATG ATCCACGACT GGGTCGACCA CCAGGAAGAC  ACAAAAGAGC AAGAGATTGT AGCTCCGGAA TCAGTCGCAG CGCAGTGTCC CTTGAAGGAA TTTCGGTTCC TCCGCACGAA AGAGGACGAA ACGGGCTCGC AAGACATCCC TTTGGGGCAT  AGGAACATGA GAACATCGTG GTGGGATGGG AGTGTTCTAT ACGGGAGCCA CGACGGTGCG CTGGCGAGGG TGCGCACTGG CAAAGATGGA AAACTTAAGA TCGGCCAAAA TGGCCTCCTT  GAGCGCGACG ATCACGGCGT CGCCATCTCC GGCGATGTCA AGAACACCTG GGCCGGGGTT TCGATTCTCC AGGCGCTTTT CGTCAAGGAG CACAATGCCG TGTGTGACAT GCTCAAGAGG  ACGCATCCGG AATTCGGGGA CGAAGAGCTC TACCTTCATG CGAGATTGGT CGTCGCTGCC GTGATTGCCA AGATTCACAC CATCGACTGG ACTGTGGAGC TGCTCAAGAC GAAAGCGCTC  GACATTGGAA TGCATGCAAA CTGGTATGGT TTACTGGGGA AGAGAATCAA GAGCTGGATC GGGCACACTG GATCCTCGCT GCTGAGTGGA TTTATTGGAA TGAAGGAGCC AATAAACCAC  GGCGTTCCTT ACGCCTTGAC GGAGGAGTTT ACGTGCGTTT ATCGCCTCCA TCCTTTGCTA CCAGACGACA TTGTGCTGAG AGACATCACT GGCAAGAGAA TGATCGCGTC GCTTGGGCAT  CAAGCTTGTG GAGCGCTCGT TCTTTTCAAC TATCCGCAGT GGATGAGGGA CCTTCCCCAG ACTGGAACCG ACGGCATAAA CCGCCCGAAT CACGTCGACA TGGCCGCCCT CGAGATTTAC  CGTGATCGCG AAAGAAAAGT TGCAAGATAC AATGCCTTTC GGAGAAACAT GTTGATGATT CCAATCAAGA AGTGGGAGGA TCTCACCGAT GACAAACAAA CACTCGCCTT GCTGAGGGAG  GTATACGGCG AGGACGTGGA GAAGCTCGAC TTGCTCGTCG GCTTGCTGGC GGAGAAGAAG ATCAAAGGCT TCGCCATTAG CGAGACGTCG TTTTTCATCT TTCTCCTCAT GGCCACCAGG  AGGCTAGAAG CTGATCGATT CTTTACCTCA AACTTTAACG CCAAGAGCTA CACCAAGGAG GGACTGGCGT GGGTGAACAA CACCGAGAGC CTCAAAGACG TCCTCCAGAG GCACCACGGC 
AACTTGGTTG ATAAGTGGCT AAACGCACGC AGCGCATTCA GCGTGTGGAG TGCGTGA 

Retrieve as FASTA