Entry information : SmPrxII03-1_20 (SmPrxIICa_20)
Entry ID 7411
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrxII03-1_20 (SmPrxIICa_20)
Name (synonym) SmPrxII03-1_20 (SmPrxIICa_20)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxII03-1_20
start..stop
S start..stop
SmPrxII03-2_86 327 3e-117 1..163 1..163
PpePrxII03 251 3e-87 1..162 1..162
GhPrxII03 249 2e-86 1..162 1..162
GaPrxII03 249 2e-86 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 155736..155890 155 N° 2 155597..155676 80 N° 3 155294..155550 257  
complement(join(155294..155550,155597..155676,155736..155890))


exon

Literature and cross-references SmPrxII03-1_20 (SmPrxIICa_20)
DNA ref. Phytozome 11:   scaffold_20 (155890..155294)
mRNA ref. JGI transcript:   148621
EST ref. GenBank:   FE489397.1
Cluster/Prediction ref. UniGene:   Smo.1607
Protein sequence: SmPrxII03-1_20 (SmPrxIICa_20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   17543.23  
PI (pH):   %s   4.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIGVEEIIPDGTLSYFDKDGKLQNVSIYALAEKKKVVLFGVPGAFTPTCSLKHVPGYIEKAPELKAKGVDKILCLVNDPFVVREWAKTYPEDSAVMFLADGSATYTKSLGLELDLTERGMGIRSKRFALLLDDLVVKAANIEEGGDFKVSSADDILAVLP

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 6 ESTs. Unigene compiles ESTs from both haplotypes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCCATCGGCGTGGAGGAGATCATCCCCGACGGCACGCTCTCCTACTTCGACAAGGATGGCAAGCTCCAGAACGTTTCCATCTACGCCCTAGCCGAGAAGAAGAAAGTGGTCCTG
TTCGGAGTTCCAGGAGCTTTCACTCCTACTTGCAG
GTGCCCTTTTCTTCTTTTCCTCTTGCAAATCGATGCGAGCTCGATCTATCTCTTTCTAGTTTGAAGCATGTCCCTGGATACATTG
AGAAGGCACCGGAGCTCAAGGCCAAGGGCGTGGACAAGATCCTGTGCTTAACTG
GTAAATCCTGATTCTTTCTCGCGATGGATTGAAACCTTTTGTCCAGTGAACGATCCTTTCGTTGTT
CGTGAATGGGCCAAGACCTATCCAGAGGATTCGGCCGTGATGTTCCTGGCAGACGGCTCCGCGACTTACACCAAGAGCTTGGGACTGGAGCTGGACCTGACGGAGCGAGGGATGGGGATT
CGATCCAAAAGGTTTGCTTTGCTGCTGGATGATCTCGTTGTCAAGGCTGCCAACATTGAGGAGGGTGGCGACTTCAAGGTCTCCAGCGCTGATGACATACTTGCGGTTCTGCCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCCATCGGCGTGGAGGAGATCATCCCCGACGGCACGCTCTCCTACTTCGACAAGGATGGCAAGCTCCAGAACGTTTCCATCTACGCCCTAGCCGAGAAGAAGAAAGTGGTCCTG
TTCGGAGTTCCAGGAGCTTTCACTCCTACTTGCAG
TTTGAAGCATGTCCCTGGATACATTGAGAAGGCACCGGAGCTCAAGGCCAAGGGCGTGGACAAGATCCTGTGCTTAACTGTGAAC
GATCCTTTCGTTGTTCGTGAATGGGCCAAGACCTATCCAGAGGATTCGGCCGTGATGTTCCTGGCAGACGGCTCCGCGACTTACACCAAGAGCTTGGGACTGGAGCTGGACCTGACGGAG
CGAGGGATGGGGATTCGATCCAAAAGGTTTGCTTTGCTGCTGGATGATCTCGTTGTCAAGGCTGCCAACATTGAGGAGGGTGGCGACTTCAAGGTCTCCAGCGCTGATGACATACTTGCG
GTTCTGCCATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCGCATTCT TTGTGAGTGT TTCTCTCTAT CTATTCCTTC CGGCAATCCA GGTAATGGCA CCCATCGGCG TGGAGGAGAT CATCCCCGAC GGCACGCTCT CCTACTTCGA CAAGGATGGC  AAGCTCCAGA ACGTTTCCAT CTACGCCCTA GCCGAGAAGA AGAAAGTGGT CCTGTTCGGA GTTCCAGGAG CTTTCACTCC TACTTGCAGT TTGAAGCATG TCCCTGGATA CATTGAGAAG  GCACCGGAGC TCAAGGCCAA GGGCGTGGAC AAGATCCTGT GCTTAACTGT GAACGATCCT TTCGTTGTTC GTGAATGGGC CAAGACCTAT CCAGAGGATT CGGCCGTGAT GTTCCTGGCA  GACGGCTCCG CGACTTACAC CAAGAGCTTG GGACTGGAGC TGGACCTGAC GGAGCGAGGG ATGGGGATTC GATCCAAAAG GTTTGCTTTG CTGCTGGATG ATCTCGTTGT CAAGGCTGCC  AACATTGAGG AGGGTGGCGA CTTCAAGGTC TCCAGCGCTG ATGACATACT TGCGGTTCTG CCATAAGTAC TACTTACTCA GTTATCAAAA GCTTTTGTTA TGTTACTTTT TGCATGGTTT 
GCCGTATTTA AGTTTAAATG TTTTTAGTGA AATATATTAC AATATTTAAA AGGCGGT 

Retrieve as FASTA