Entry information : SmPrxII03-2_86 (SmPrxIICb_86)
Entry ID 7412
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrxII03-2_86 (SmPrxIICb_86)
Name (synonym) SmPrxII03-2_86 (SmPrxIICb_86)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxII03-2_86
start..stop
S start..stop
SmPrxII03-1_20 327 3e-117 1..163 1..163
PpePrxII03 249 1e-86 1..162 1..162
GhPrxII03 247 7e-86 1..162 1..162
GaPrxII03 247 7e-86 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 786337..786491 155 N° 2 786551..786630 80 N° 3 786677..786933 257  
join(786337..786491,786551..786630,786677..786933)


exon

Literature and cross-references SmPrxII03-2_86 (SmPrxIICb_86)
DNA ref. Phytozome 11:   scaffold_86 (786337..786933)
mRNA ref. JGI transcript:   159225
EST ref. GenBank:   FE495257.1
Protein sequence: SmPrxII03-2_86 (SmPrxIICb_86)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   17529.22  
PI (pH):   %s   4.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIGVEEIIPDGTLSYFDKDGKLQNVSIYALAEKKKVVLFGVPGAFTPTCSLKHVPGYIDKAPELKAKGVDKILCLVNDPFVVREWAKTYPEDSAVMFLADGSATYTKSLGLELDLTERGMGIRSKRFALLLDDLVVKAANIEEGGDFKVSSADDILAVLP

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron) and 4 ESTs (FE495256.1, FE497934.1, FE497935.1). Unigene compiles ESTs from both haplotypes.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCCATCGGCGTGGAGGAGATCATCCCCGACGGCACGCTCTCCTACTTCGACAAGGATGGCAAGCTCCAGAACGTTTCCATCTACGCCCTAGCCGAGAAGAAGAAAGTGGTCCTG
TTCGGAGTTCCAGGAGCTTTCACTCCTACTTGCAG
GTGCCCTTTTCTTCTTTTCCTCTTGCAAATCAATGCGAGCTCGATCTATCTCTTTCTAGCTTGAAGCATGTCCCTGGATACATTG
ACAAGGCACCGGAGCTCAAGGCCAAGGGCGTGGATAAGATCCTGTGCTTGACTG
GTAAATCCTGATTCTTTCTCGCGATGGATTGAAACCTTTTGTCCAGTGAACGATCCTTTCGTTGTT
CGTGAATGGGCCAAGACCTATCCAGAGGATTCGGCCGTGATGTTCCTGGCAGACGGCTCCGCGACTTACACCAAGAGCTTGGGACTGGAGCTGGACCTGACGGAGCGAGGCATGGGGATT
CGATCCAAAAGGTTTGCTTTGCTGCTGGATGATCTCGTTGTCAAGGCTGCCAACATTGAGGAGGGTGGCGACTTCAAGGTCTCCAGCGCTGATGACATACTTGCGGTTCTGCCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCCATCGGCGTGGAGGAGATCATCCCCGACGGCACGCTCTCCTACTTCGACAAGGATGGCAAGCTCCAGAACGTTTCCATCTACGCCCTAGCCGAGAAGAAGAAAGTGGTCCTG
TTCGGAGTTCCAGGAGCTTTCACTCCTACTTGCAG
CTTGAAGCATGTCCCTGGATACATTGACAAGGCACCGGAGCTCAAGGCCAAGGGCGTGGATAAGATCCTGTGCTTGACTGTGAAC
GATCCTTTCGTTGTTCGTGAATGGGCCAAGACCTATCCAGAGGATTCGGCCGTGATGTTCCTGGCAGACGGCTCCGCGACTTACACCAAGAGCTTGGGACTGGAGCTGGACCTGACGGAG
CGAGGCATGGGGATTCGATCCAAAAGGTTTGCTTTGCTGCTGGATGATCTCGTTGTCAAGGCTGCCAACATTGAGGAGGGTGGCGACTTCAAGGTCTCCAGCGCTGATGACATACTTGCG
GTTCTGCCATAA

Retrieve as FASTA