Entry information : SbAPx03 (Sobic.006G021100.1 [2.1] / Sb06g001970 [1.4])
Entry ID 7415
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbAPx03 (Sobic.006G021100.1 [2.1] / Sb06g001970 [1.4])
Name (synonym) SbAPx03 (Sobic.006G021100.1 [2.1] / Sb06g001970 [1.4])
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbAPx03
start..stop
S start..stop
ZmAPx03 521 0 1..290 1..290
SiAPx10 508 0 2..289 4..291
OsAPx03 484 3e-175 2..289 3..290
BdiAPx06 464 2e-167 3..289 5..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3609099..3609211 113 N° 2 3609311..3609435 125 N° 3 3609539..3609588 50 N° 4 3609679..3609744 66
N° 5 3609850..3609898 49 N° 6 3610172..3610254 83 N° 7 3610406..3610485 80 N° 8 3610606..3610708 103
N° 9 3611552..3611755 204  
join(3609099..3609211,3609311..3609435,3609539..3609588,3609679..3609744,3609850 ..3609898,3610172..3610254,3610406..3610485,3610606..3610708,3611552..3611755)


exon

Literature and cross-references SbAPx03 (Sobic.006G021100.1 [2.1] / Sb06g001970 [1.4])
DNA ref. Phytozome 12:   chromosome_6 (3609099..3611755)
Protein sequence: SbAPx03 (Sobic.006G021100.1 [2.1] / Sb06g001970 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   290
PWM (Da):   %s   31734.25 Transmb domain:   %s   o261-283i
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAPMVDADYMAEIERARRDLRALISSKNCAPIILRLAWHDAGTYDAKTNTGGPNGSIRLPQEYSHSSNAGLKIAIDLEPIKQKHTKITYADLYLTGVVAVEVTGGPTIDFVPGRKDSSACPEEGRLPDARKGASHLREVFYRMGLSDKDIVALSGGHTGRAHPERTGFDGPWTKEPLKFDNSYFVELLKGDSEGLLKLPTDKVLVEDPEFRQYVELYADEEAFFRDYAESHKKLSELGFTPPRSSFTCKSGNKQKSLLVQAAAGVAVAAAVVALAYLCESNKKFI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 8 introns) and 15 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCACCCATGGTGGACGCCGATTACATGGCCGAGATCGAGAGGGCGCGGCGGGACCTCCGCGCCCTCATCTCCAGCAAGAACTGCGCGCCCATCATACTCCGCCTCGCGTACGAC
CTCATCACAAACATGTGTGGCGTGGTGTGGTCTGATTTGCTTGTAACATCTTCTTGCTGAACATCCAATGGCTTTTTTTTCTGATGTTGCAGATGGCATGACGCCGGCACTTACGACGCC
AAGACCAACACCGGAGGCCCCAACGGGTCCATAAGGCTCCCACAGGAGTACAGCCACTCTTCAAATGCAGGGCTCAAGATTGCCATTGACCTGCTAG
GTCAGTTTTTTTCTAGCTCCTAG
TAGTGAACATATATTTGGAGTCAGATACATCAAGTGGATCAAGTCTTGATGACACCACACTTCTGCTTCCTCCTGCGCAGAGCCAATAAAACAGAAGCACACCAAGATCACATATGCAGA
CCTGTATCAG
GTACTACAGTCTACAGCTATGTCCCCATGGACTATTTATTTACTCAATTGATGCATACCATGGTTAATTGAATTGTGTTTCATCAACTAGCTCACCGGAGTTGTCGCCGT
CGAAGTTACTGGTGGACCAACCATTGATTTCGTTCCTGGCAGAAAG
GTTAGTTAGTACTGTACAAGTGGCAACCTCAGATTCTATCATTACTGAGTATATATCATCTTGTCAGAGCTTCT
TATTCTAGCTTTTCATGTCTGTAATAACCAGGATTCGTCGGCTTGTCCAGAAGAAGGACGCTTGCCAGATGCTAGAAAAGGTTGCTTCGTAACACATCTTTAGAAGCTTCTTTATATATA
TATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAAGATACACAGAATTGGTACACACAAG
AGAGTTTTCAGCATTACAACGTACCTTCGATGTTTATGGGACGGATGTTCCAAATTCAGCTCTTCTGCATTACTGAAAAACTTTCAATTCTTCTTGCTCTTATCTGTCACAAGGTGCTTC
GCATCTTAGAGAAGTCTTCTACCGGATGGGTTTATCTGACAAGGACATTGTGGCACTCTCCGGCGGTCATACTCTG
GTACACAAGAACATCTTTTCTTGTTCATGCATTATAGCAAGCAT
ATTTTTTTTCTTAGAGAAGGGTTAACAAATATGAACATGGTCTCAATTAGATTAACGTGGTTTAGTTCCTTTTTATCTAAATTTGTGCCACACAATGCAAATTTCAGGGAAGAGCACATC
CAGAGAGGACAGGATTTGATGGCCCATGGACCAAGGAACCTCTGAAATTTGACAACTCTTATTTTGT
GTAAGCCTTAAGCTGACTATTTCAAAAACCTAACACACGATTATTGCCTTTAT
TTTTTCTCAGATTATTATGGTTGGTAATGTCACACCTGTGTATATCACTTCACATCCAATGATGCAGTGAGCTTCTGAAAGGCGATTCTGAAGGGCTCTTGAAACTCCCTACTGACAAGG
TTCTTGTGGAAGATCCTGAATTCCGTCAGTACGTCGAACTATATGCCAAG
GTACACAACTATTCAGTTACCTTCTTCCATTCTTGCTCGAACAGTTCCTGAAACCTTATAAAAAAAATAC
CTTATCAGAAAAAAATAATGGTTCTTGAAACAGAATTCATTGTTTTCATTTGATCTCGAATTGTCAATAAAACCTAAATCAGGTAGGCACTGACATTTTCTGCATTTTATTTTTATCATT
TCTCCCTTCTGAATCATAGAACTATAATTACGTGCCAAAATAAAACTATAATAATCCAACTACAGAGTGAAGCTTCAGTGTTCGAATCAAGGCCAGCAGAAATCGAGGGGCTGATTGGCT
CTCTACCCAGCCTTGCCAATGCTTGCCTTATAAACTTTAGTTGCATCAACAAAATTTTCAAGCATTTAGTTTGTTAGCAAACTTAGTCAAGATTCATTATGTTCAGTTCATTTCTGGCTA
ATATCTAGCCAAATCATTTGAGAACAAACTGGTGGACAATATATGGTAATGCCAACCTTTTGTATGGCTTGGTGAGCTAAAGTTGGTGTCAAACAAACAACTTAGAAATCAATAGGCCTA
TAGCACATGTTGTGGTAGGTTTGGCCCTGGACGTGCTGCATCAGCAACCTAGTCAATACAGGATTAGTTGTTCCATGGTTTGTTCAGGTCTGCATCCAAGTAACTATCAATCTATCTGCT
TAACAAACATGAATAAACTAGCAAACTTTGGAAAGCAGTCCATTGACTAGGCTGCTGACAGCATATCCAGGGCCAGAGCCGGGGCACTTGCCATAACCATAACACTCCTTTTATATAGTA
GTTGAAATTAATCCTTGTTTGTCCACTAATCATTTTGCCTACCTTATTTGCAGGATGAAGAAGCTTTCTTTAGGGACTACGCGGAGTCACACAAGAAACTCTCAGAGCTAGGCTTCACAC
CGCCTCGCTCTTCTTTCACATGCAAATCCGGAAATAAACAAAAGTCCCTGCTGGTGCAAGCTGCAGCTGGGGTCGCAGTTGCTGCTGCAGTTGTCGCATTGGCGTACCTGTGCGAATCCA
ACAAGAAGTTCATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCACCCATGGTGGACGCCGATTACATGGCCGAGATCGAGAGGGCGCGGCGGGACCTCCGCGCCCTCATCTCCAGCAAGAACTGCGCGCCCATCATACTCCGCCTCGCATGGCAT
GACGCCGGCACTTACGACGCCAAGACCAACACCGGAGGCCCCAACGGGTCCATAAGGCTCCCACAGGAGTACAGCCACTCTTCAAATGCAGGGCTCAAGATTGCCATTGACCTGCTAG
AG
CCAATAAAACAGAAGCACACCAAGATCACATATGCAGACCTGTATCAG
CTCACCGGAGTTGTCGCCGTCGAAGTTACTGGTGGACCAACCATTGATTTCGTTCCTGGCAGAAAGGATTCG
TCGGCTTGTCCAGAAGAAGGACGCTTGCCAGATGCTAGAAAAG
GTGCTTCGCATCTTAGAGAAGTCTTCTACCGGATGGGTTTATCTGACAAGGACATTGTGGCACTCTCCGGCGGTCAT
ACTCTG
GGAAGAGCACATCCAGAGAGGACAGGATTTGATGGCCCATGGACCAAGGAACCTCTGAAATTTGACAACTCTTATTTTGTTGAGCTTCTGAAAGGCGATTCTGAAGGGCTCTTG
AAACTCCCTACTGACAAGGTTCTTGTGGAAGATCCTGAATTCCGTCAGTACGTCGAACTATATGCCAAG
GATGAAGAAGCTTTCTTTAGGGACTACGCGGAGTCACACAAGAAACTCTCA
GAGCTAGGCTTCACACCGCCTCGCTCTTCTTTCACATGCAAATCCGGAAATAAACAAAAGTCCCTGCTGGTGCAAGCTGCAGCTGGGGTCGCAGTTGCTGCTGCAGTTGTCGCATTGGCG
TACCTGTGCGAATCCAACAAGAAGTTCATCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACCAAACCA GAGCTGCTGC TGCTGCCCTG TTTCTTGTCC ACAGCTGCTG CTGCTGCTTC ACTTCCTCTG CTTACACAGA GCAACCAGTT GTCAGCAGCA ATGTCTGCAC CCATGGTGGA  CGCCGATTAC ATGGCCGAGA TCGAGAGGGC GCGGCGGGAC CTCCGCGCCC TCATCTCCAG CAAGAACTGC GCGCCCATCA TACTCCGCCT CGCATGGCAT GACGCCGGCA CTTACGACGC  CAAGACCAAC ACCGGAGGCC CCAACGGGTC CATAAGGCTC CCACAGGAGT ACAGCCACTC TTCAAATGCA GGGCTCAAGA TTGCCATTGA CCTGCTAGAG CCAATAAAAC AGAAGCACAC  CAAGATCACA TATGCAGACC TGTATCAGCT CACCGGAGTT GTCGCCGTCG AAGTTACTGG TGGACCAACC ATTGATTTCG TTCCTGGCAG AAAGGATTCG TCGGCTTGTC CAGAAGAAGG  ACGCTTGCCA GATGCTAGAA AAGGTGCTTC GCATCTTAGA GAAGTCTTCT ACCGGATGGG TTTATCTGAC AAGGACATTG TGGCACTCTC CGGCGGTCAT ACTCTGGGAA GAGCACATCC  AGAGAGGACA GGATTTGATG GCCCATGGAC CAAGGAACCT CTGAAATTTG ACAACTCTTA TTTTGTTGAG CTTCTGAAAG GCGATTCTGA AGGGCTCTTG AAACTCCCTA CTGACAAGGT  TCTTGTGGAA GATCCTGAAT TCCGTCAGTA CGTCGAACTA TATGCCAAGG ATGAAGAAGC TTTCTTTAGG GACTACGCGG AGTCACACAA GAAACTCTCA GAGCTAGGCT TCACACCGCC  TCGCTCTTCT TTCACATGCA AATCCGGAAA TAAACAAAAG TCCCTGCTGG TGCAAGCTGC AGCTGGGGTC GCAGTTGCTG CTGCAGTTGT CGCATTGGCG TACCTGTGCG AATCCAACAA  GAAGTTCATC TAACTTATGC TCACCATTAG TACAGCAACA GTGGTGGAGG GTTGAAACTG GAGGAGTCGA AATATTTCAG TGCTGTCCAC TTGTATTTGC ACCATGTGGC TACTTATTGA 
TAATACCAAG CGTGTTATGT GTTGTGAAGA GGTCAAAGAA TGAAATAAAG ACAAATCTAA AAATAAGAGC AAAAAAAAAA AGCTCTGACT TGGTGCCCAA A 

Retrieve as FASTA