Entry information : SbPrxII06 (Sobic.003G124300.1 [2.1] / Sb03g010530 [1.4] / SbPrxIIF)
Entry ID 7419
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrxII06 (Sobic.003G124300.1 [2.1] / Sb03g010530 [1.4] / SbPrxIIF)
Name (synonym) SbPrxII06 (Sobic.003G124300.1 [2.1] / Sb03g010530 [1.4] / SbPrxIIF)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrxII06
start..stop
S start..stop
ZmPrxII06 370 1e-133 1..193 1..193
OsPrxII06 319 5e-113 28..193 33..198
EgrPrxII02 309 4e-109 1..193 1..196
EguPrxII02 306 3e-108 1..193 1..196
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11363164..11363355 192 N° 2 11363016..11363045 30 N° 3 11362132..11362290 159 N° 4 11361176..11361270 95
N° 5 11360612..11360717 106  
complement(join(11360612..11360717,11361176..11361270,11362132..11362290,1136301 6..11363045,11363164..11363355))


exon

Literature and cross-references SbPrxII06 (Sobic.003G124300.1 [2.1] / Sb03g010530 [1.4] / SbPrxIIF)
DNA ref. Phytozome 11:   chromosome_3 (11363355..11360612)
Protein sequence: SbPrxII06 (Sobic.003G124300.1 [2.1] / Sb03g010530 [1.4] / SbPrxIIF)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193
PWM (Da):   %s   20570.67  
PI (pH):   %s   8.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPLARRAGRSAAAALWGAARGFASVGSDIVSAAPGVSLQKARSWDEGVATKFATTPLKDIFYGKKVVIFGLPGAYTGVCSQAHVPSYKKNIDKLKAKGIDSVICVAVNDPYVLNGWAEKLEAKDAIEFYGDFDGSFHKSLDLEIDLSAALLGRRSHRWSAFVDNGKIKSFNVEEVPSDFKVSSAEVILDQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 4 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGCCGCTGGCGAGGAGGGCGGGGCGCTCCGCGGCGGCGGCGCTATGGGGCGCGGCTAGGGGCTTCGCGTCGGTGGGGTCCGACATCGTCTCGGCCGCGCCCGGCGTGTCGCTG
CAGAAGGCGCGGTCCTGGGACGAGGGCGTCGCCACCAAGTTCGCCACCACGCCTCTCAAGGACATCTTCTAC
GTGCGCAGCGCTGCTCTTCCCACATCGCCCATGTCTTCTTCTTCTTCT
AGATAGTCCATACCGGCCGATTCAGTTGTGTTGACCCGGGATTCTTTGCTTGCTGTCCTTTTGCTTGCAGGGGAAGAAGGTGGTCATCTTCGGCTTGCCCGTAAGTTCGCCTCCTCACTA
CTTCCATTCCGCTCTCCATGTAGATGTTTGGCCATTTTAGGGTCGCTAGATGAGGCCGTTGTTTGCATTGGTGCGGAATTATTTCGTTAGGTTTGCTAGGTCTGAATTTGCATTTGGGGA
TTAGGGATGCCTCAGTAGAACGTTGTTTATGGGTGTTTAAACGTGATATTTGCAATGGCATGTATCCAATTAACCCTCTTTTTTATTGTTAAGACGTTGATTTGGTAAATAGACGTAAGA
ATTGGGAATGGGAAGTTATGTTGTAATGTTGTTTCAGTGACCATGGTGAAATCTGAATGCTGTATCTTATATATTGGATGGTGTTTCTACAAACTAGAGGTGTTCATCTCTGATGCCTAG
GAGAAAACATTACATTTCATTCGTCTCATCTGATAGGGCAATAAGGATAGGTGTACTCCATGATACTCGAGGACAATGTTGTAAGAGCATAACACAGAATCCATGTTCCATTTTTCTAAG
CCATGAAAAAACATTGTGATTGTGACACATTACACCCTACTCCCAGAGTTTCTAGTCATTGTTGTTTCCTTGGCAATTCAGTACATTGGAATTTGTAAACTTACACCTTTGGTATTGTTC
TTTGTATTGTCTTTCTCCATCTTTTATTCTGAAAGGCAGAATTCTCTCACTTCAAATGTTCTAATGACCATATGGTTTGGCAACTATCTTTTCAATTTATTGCAGGGTGCATATACAGGG
GTTTGTTCACAAGCACATGTTCCTAGTTACAAGAAGAATATTGACAAGTTGAAAGCAAAAGGAATCGACTCTGTTATCTGTGTAGCTGTGAATGATCCATATGTCCTGAATGGATGGGCA
GAAAAGCTAGAGGCCAAAGATGCA
GTAAGTAACTACCCTTCAATCTTTATTCTTTACTTGATTACCAAGTTATTAGCACATAATCTGAAATATAATGAGGGCATATAACGTATGTATCCA
AGTAATTGTGCTATTATCAATGTGATATGACTATCTGCCTTTTGCTGTCCGGTGTTATTACTTGTTTGGTGTTCTCAACTACATAAATGTTTGTCATCATTATATTCCCATCATTTGTTG
CTATTGACAATTGTCCTATATGCAGTCAACCTGTGATGTTTTCCTTGTTCTCCCACCTGCCCTTGTTTAGTTCCAAATTTTTTTGCAAAATGGACATTGCAGCATTTTTGTTTGTATTTG
ACAAATATTGTCCAATCATGGACTAACTAGGCTCAAAAGATTCGTCTAGCAAATTACAGGCAAACTGTGCAATTCGTTATTTTTTTATCTATATTTAATACTCCATGCATGTGCCGCAAG
ATTCGATGTGACGGGGAATCTGAAAACCTAGCAAACCTAATGCAGCATTTTTGCAATTTTTTTTGGACCTAGCAAACCTAACGAAATAATTCAGATGTGGTGCTTTTTTTTATACTTCTG
CTGCACTCTGTTCACCTTGGTGCATTAAACTACAAAATGCAAATTTCATGTCATGTCTCGTAAAGCTCACCCCAATTTCTCTATACTGATGAATGATTGAATGATCTAATTTAGATATAA
AATTTATGGGAAACATGTTTCAGATGTATCATCTTAGGATCTTAGCCAAAAAAACCTGCAAATTTGAGTACGTGCAGTTGCTAGTTATTTGTAACTTTATATTAATTCCCTTGAGATCAT
ATGCATATTCATATTTTTCCTATGTGCAATGATTGGAAAATATAGATTGAGTTCTACGGTGACTTTGATGGGAGTTTCCACAAAAGCTTGGATTTGGAGATAGACCTTTCTGCTGCTTTG
CTTGGCCGCCGTTCTCACAG
GTTATTGGATTTAACTTGCAGTCATTCTTAAACTTGTGCCCTTATATTACAGTTGAAGATTGGTGTTATGTAGTTTAATACTGAATTACTGCCTGATTAG
TAAAGCTCTTCTGAGTTCTGACAAAATTGTCCTTGTTTAGTTGAATGTCTCTTTGGACACCTTTATGTAATTTATTTCCAGCCATGCCCTTGTCAGCTGAACCACATGCTATAGCTGCAT
ACAAAATTGTGAATGACCACCATATAGTGAAGTGTTGCTTTCATTCACTAGGTTCATAATACTATAGAGGACATCCCTGTCTAACATGATAACAACCGTTCTTAGAGTATCTTTTACATT
TCCCCATTAATAATCAAGGAAAGTATACTTCATTTCCAGTGCTCATGAGTAACAACAATACATCTTATGCTTGGTTTATGTCTTCTGGTCTAAATCTTGACAACATTGTCATTTTTAGGT
GGTCAGCCTTTGTTGACAATGGTAAGATCAAGTCTTTCAATGTTGAGGAAGTACCGTCCGACTTTAAGGTTTCTAGTGCAGAGGTGATCCTGGACCAGATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGCCGCTGGCGAGGAGGGCGGGGCGCTCCGCGGCGGCGGCGCTATGGGGCGCGGCTAGGGGCTTCGCGTCGGTGGGGTCCGACATCGTCTCGGCCGCGCCCGGCGTGTCGCTG
CAGAAGGCGCGGTCCTGGGACGAGGGCGTCGCCACCAAGTTCGCCACCACGCCTCTCAAGGACATCTTCTAC
GGGAAGAAGGTGGTCATCTTCGGCTTGCCCGGTGCATATACAGGGGTT
TGTTCACAAGCACATGTTCCTAGTTACAAGAAGAATATTGACAAGTTGAAAGCAAAAGGAATCGACTCTGTTATCTGTGTAGCTGTGAATGATCCATATGTCCTGAATGGATGGGCAGAA
AAGCTAGAGGCCAAAGATGCA
ATTGAGTTCTACGGTGACTTTGATGGGAGTTTCCACAAAAGCTTGGATTTGGAGATAGACCTTTCTGCTGCTTTGCTTGGCCGCCGTTCTCACAGGTGG
TCAGCCTTTGTTGACAATGGTAAGATCAAGTCTTTCAATGTTGAGGAAGTACCGTCCGACTTTAAGGTTTCTAGTGCAGAGGTGATCCTGGACCAGATCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTTTCTAAC TCGACTATTG TGGGAGAGAG ACACAGAATC GGAAAAGGAA TCCATGGCGG CGCCGCTGGC GAGGAGGGCG GGGCGCTCCG CGGCGGCGGC GCTATGGGGC GCGGCTAGGG  GCTTCGCGTC GGTGGGGTCC GACATCGTCT CGGCCGCGCC CGGCGTGTCG CTGCAGAAGG CGCGGTCCTG GGACGAGGGC GTCGCCACCA AGTTCGCCAC CACGCCTCTC AAGGACATCT  TCTACGGGAA GAAGGTGGTC ATCTTCGGCT TGCCCGGTGC ATATACAGGG GTTTGTTCAC AAGCACATGT TCCTAGTTAC AAGAAGAATA TTGACAAGTT GAAAGCAAAA GGAATCGACT  CTGTTATCTG TGTAGCTGTG AATGATCCAT ATGTCCTGAA TGGATGGGCA GAAAAGCTAG AGGCCAAAGA TGCAATTGAG TTCTACGGTG ACTTTGATGG GAGTTTCCAC AAAAGCTTGG  ATTTGGAGAT AGACCTTTCT GCTGCTTTGC TTGGCCGCCG TTCTCACAGG TGGTCAGCCT TTGTTGACAA TGGTAAGATC AAGTCTTTCA ATGTTGAGGA AGTACCGTCC GACTTTAAGG  TTTCTAGTGC AGAGGTGATC CTGGACCAGA TCTGAGCTTG TCAATGAACT TGGGCTATCT ATCTTCAGTT TGTGGGGCAT ACTTCCTCTG CAGCTGCGAA TAAATTAAAT CTCTTACGAC 
CCGTGTAAGA TGTTTAGATA CACTGCGCCC AGACTAAGGA ATCAGAGTGT ATGACATCTG TTTTTCTGGA ATGAATTAAT CGGTGTTCA 

Retrieve as FASTA