Entry information : PpaGPx03
Entry ID 7431
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2010-06-04 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: PpaGPx03
Name PpaGPx03
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaGPx03
start..stop
S start..stop
AfpGPx01 175 4e-56 1..146 88..230
TaGPx04-1A 173 2e-55 1..146 78..220
CpslGPx01 173 3e-55 2..147 89..232
WnoGPx01 173 3e-55 1..146 92..234
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 173315..173394 80 N° 2 173625..173686 62 N° 3 173812..173930 119 N° 4 174030..174296 267
join(173315..173394,173625..173686,173812..173930,174030..174296)


exon

Literature and cross-references PpaGPx03
DNA ref. Phytozome 11:   scaffold_313 (173315..174296)
Protein sequence: PpaGPx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   175
PWM (Da):   %s   19850.19  
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QDIDGVDTKLSKYANKIIVLLNVASYCGLTDRNYTELQEIYDKYKKGLEVLAFPCNQFAETEPGTHMQIKKFVKKTYNGTFPLFAIEVNGPNQHELFKYLKATSGGIRGFYRDNLKWNFAKFVIGKDGVVIERFAPTSSPRMIEVSRLSFSIPKISLTNSCAECYLCLQIEYD*

Retrieve as FASTA  
Remarks Partial sequence from genomic. First and last exons are missing (last SRLSFSIPKISLTNSCAECYLCLQIEYD is probably incorrectly predicted). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACATTGACGGAGTGGATACGAAACTGAGCAAATATGCTAACAAGATCATAGTTCTCTTGAATGTCGCTTCCTACTGGTAATGTACACTTCCTTTTTCAACAGATGCAAGTCATTCG
CGTAACGCAGTACCTGGAACATGCTGATTAGGTCTTCATATTTTGGTTCCTTAAGTAATTATTTTCTGAAACCATTTTACGGTTACTTTTTGAAAATCCAAGGTGGCTGGAAATTGATGT
CAAACATTCATTCAAAACCTTCGAACTCAGCTGAGAGTGCATTCTCGTGTTTTTTTTCTTTTGCCCACAGCGGGCTCACTGACAGGAATTATACCGAATTGCAAGAGATTTATGACAAGT
ATAAAAAAGATG
GTATCTTCCCATTTTCCAAGCATTTCTATTCTGACCGAGTCACAGAAACAGGGGATACTTAGATCTGTGCTGGATGTGCTAATCTGTGTGTGGTTTTGTTGGTCCCCT
TTGGTGCTGGGTTGAAGGGCTTGAGGTCTTGGCATTTCCGTGTAATCAGTTCGCCGAAACGGAACCCGGAACACATATGCAGATTAAAAAGTTTGTAAAGAAAACGTACAACGGAACGTT
TCCTCTCTTTGCCAAG
GTAAGTCTCTCCAGAGGGCTCCGAACAGTTGCACACTAAGTTACTGGAAATGTCGATCATTATTCAAGCGTCACACGGACGTTTGAAATGCTTGGGTAGATTGA
AGTGAATGGGCCCAACCAGCATGAATTATTCAAGTATTTGAAAGCCACAAGTGGTGGAATCAGAGGATTCTACCGGGATAACCTCAAGTGGAACTTCGCCAAGTTTGTCATTGGCAAAGA
TGGTGTCGTTATCGAGCGATTTGCTCCAACGAGTTCTCCAAGGATGATTGAGGTGAGCAGGTTGTCATTCTCAATACCTAAGATCTCTTTAACTAATTCGTGCGCGGAGTGTTATCTTTG
TTTGCAGATTGAGTATGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACATTGACGGAGTGGATACGAAACTGAGCAAATATGCTAACAAGATCATAGTTCTCTTGAATGTCGCTTCCTACTGCGGGCTCACTGACAGGAATTATACCGAATTGCAAGAGATT
TATGACAAGTATAAAAAAGATG
GGCTTGAGGTCTTGGCATTTCCGTGTAATCAGTTCGCCGAAACGGAACCCGGAACACATATGCAGATTAAAAAGTTTGTAAAGAAAACGTACAACGGA
ACGTTTCCTCTCTTTGCCAAG
ATTGAAGTGAATGGGCCCAACCAGCATGAATTATTCAAGTATTTGAAAGCCACAAGTGGTGGAATCAGAGGATTCTACCGGGATAACCTCAAGTGGAAC
TTCGCCAAGTTTGTCATTGGCAAAGATGGTGTCGTTATCGAGCGATTTGCTCCAACGAGTTCTCCAAGGATGATTGAGGTGAGCAGGTTGTCATTCTCAATACCTAAGATCTCTTTAACT
AATTCGTGCGCGGAGTGTTATCTTTGTTTGCAGATTGAGTATGACTAG

Retrieve as FASTA