Entry information : ZmPrx48
Entry ID 744
Creation 2006-06-05 (Christophe Dunand)
Last sequence changes 2006-06-05
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx48
Name ZmPrx48
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Etiolated seedlings
Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx48
start..stop
S start..stop
SbPrx135 580 0 1..313 1..313
SbPrx134 576 0 1..313 1..314
SiPrx37 568 0 1..313 1..311
CciPrx01 513 0 1..313 1..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59941270..59941476 207 N° 2 59940966..59941145 180 N° 3 59940297..59940851 555  
complement(join(59940297..59940851,59940966..59941145,59941270..59941476))


exon

Literature and cross-references ZmPrx48
Literature Duvick,J.P., Maddox,J.R., Navarro Acevedo,P.A. and Simmons,C.R. Maize peroxidase genes and their use for improving plant disease resistance and stalk strength.
Protein ref. UniProtKB:   B6SMR2 [Other strain]
DNA ref. GenBank:   AC203532.3 (16303..17479)
mRNA ref. GenBank:   AX546765 [Mismatch]
Cluster/Prediction ref. UniGene:   Zm.27756
Protein sequence: ZmPrx48
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 313 (291)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
32832.46 (30606.4)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
8.27 (8.40) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 23 range:23-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPTLMQCLVAVSLLSCVAHAQLSPTFYASSCPNLQSIVRAAMTQAVASEQRMGASLLRLFFHDCFVQGCDGSILLDAGGEKTAGPNLNSVRGFEVIDTIKRNVEAACPGVVSCADILALAARDGTNLLGGPTWSVPLGRRDSTTASASLANSNLPPPTASLGTLISLFGRQGLSPRDMTALSGAHTIGQARCTTFRGRIYGDTDINASFAALRQQTCPRSGGDGNLAPIDVQTPVRFDTAYFTNLLSRRGLFHSDQELFNGGSQDALVRQYSASASLFNADFVAAMIRMGNVGVLTGTAGQIRRNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 2, introns 1 and 2) and 18 ESTs. Also found in AC145452.7 (28174-29350). Cultivar="B73" and "Hybrid 35A19".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTCCCACCTTGATGCAATGCCTGGTCGCCGTTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGCCCACGTTCTATGCGTCCTCCTGCCCCAACCTGCAGAGCATCGTT
CGGGCGGCGATGACCCAGGCCGTCGCAAGTGAGCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTCGTTCAA
GTATACTAGCTAGAATCCTCACACTATTATATA
TTCTTATAACAGCTAGCTAACAACACACAGCTCAATAATTTGACTGCGATGCATCATGACATGTGTATGCGACGGTGATGCATGATGACAGGGCTGCGACGGATCGATCCTTCTCGACGC
CGGAGGGGAGAAGACCGCCGGGCCGAACCTGAACTCGGTGCGCGGCTTTGAGGTCATCGACACCATCAAGCGGAACGTCGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCT
CGCGCTTGCCGCGCGCGACGGAACCAACCTT
GTACGCACGCGCGCGCCTTCTAGCTAGTTTGCATGGACGGTCAAACCGCTCGCGTCGTCGATCGTCTGACACTTTTCCTTTGCTTCGTT
GTGCATCTCCGTACGTTACGTATAGCTCGGCGGGCCGACCTGGAGCGTGCCGCTCGGGCGGCGGGACTCGACGACGGCCAGCGCCTCGCTCGCCAACAGCAACCTCCCGCCCCCGACGGC
CAGCCTCGGCACGCTCATCTCCCTGTTCGGCAGGCAGGGCCTGTCGCCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCATCGGGCAGGCCCGGTGCACCACCTTCCGCGGCCGCAT
CTACGGCGACACCGACATCAACGCCTCCTTCGCGGCGCTGCGGCAGCAGACGTGCCCGCGGTCCGGCGGCGACGGCAACCTGGCGCCCATCGACGTGCAGACGCCGGTGAGGTTCGACAC
GGCCTACTTCACCAACCTGCTGTCGCGGAGGGGCCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAGCGCCTCGCTCTTCAA
CGCCGACTTCGTGGCAGCCATGATTAGGATGGGCAACGTTGGGGTGCTCACCGGCACCGCTGGACAGATCAGGCGCAACTGCCGGGTCGTCAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTCCCACCTTGATGCAATGCCTGGTCGCCGTTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGCCCACGTTCTATGCGTCCTCCTGCCCCAACCTGCAGAGCATCGTT
CGGGCGGCGATGACCCAGGCCGTCGCAAGTGAGCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTCGTTCAA
GGCTGCGACGGATCGATCCTTCTCGACGCCGGA
GGGGAGAAGACCGCCGGGCCGAACCTGAACTCGGTGCGCGGCTTTGAGGTCATCGACACCATCAAGCGGAACGTCGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCTCGCG
CTTGCCGCGCGCGACGGAACCAACCTT
CTCGGCGGGCCGACCTGGAGCGTGCCGCTCGGGCGGCGGGACTCGACGACGGCCAGCGCCTCGCTCGCCAACAGCAACCTCCCGCCCCCGACG
GCCAGCCTCGGCACGCTCATCTCCCTGTTCGGCAGGCAGGGCCTGTCGCCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCATCGGGCAGGCCCGGTGCACCACCTTCCGCGGCCGC
ATCTACGGCGACACCGACATCAACGCCTCCTTCGCGGCGCTGCGGCAGCAGACGTGCCCGCGGTCCGGCGGCGACGGCAACCTGGCGCCCATCGACGTGCAGACGCCGGTGAGGTTCGAC
ACGGCCTACTTCACCAACCTGCTGTCGCGGAGGGGCCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAGCGCCTCGCTCTTC
AACGCCGACTTCGTGGCAGCCATGATTAGGATGGGCAACGTTGGGGTGCTCACCGGCACCGCTGGACAGATCAGGCGCAACTGCCGGGTCGTCAACAGCTAG

Retrieve as FASTA