Entry information : ZmPrx48
Entry ID 744
Creation 2006-06-05 (Christophe Dunand)
Last sequence changes 2006-06-05
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx48
Name ZmPrx48
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Etiolated seedlings
Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx48
start..stop
S start..stop
SbPrx135 580 0 1..313 1..313
SbPrx134 576 0 1..313 1..314
SiPrx37 568 0 1..313 1..311
CciPrx01 513 0 1..313 1..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59941270..59941476 207 N° 2 59940966..59941145 180 N° 3 59940297..59940851 555  
complement(join(59940297..59940851,59940966..59941145,59941270..59941476))


exon

Literature and cross-references ZmPrx48
Literature Duvick,J.P., Maddox,J.R., Navarro Acevedo,P.A. and Simmons,C.R. Maize peroxidase genes and their use for improving plant disease resistance and stalk strength.
Protein ref. UniProtKB:   B6SMR2 [Other strain]
DNA ref. GenBank:   AC203532.3 (16303..17479)
mRNA ref. GenBank:   AX546765 [Mismatch]
Cluster/Prediction ref. UniGene:   Zm.27756
Protein sequence: ZmPrx48
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (291)
PWM (Da):   %s   32832.46 (30606.4)  
PI (pH):   %s   8.27 (8.40) Peptide Signal:   %s   cut: 23 range:23-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPTLMQCLVAVSLLSCVAHAQLSPTFYASSCPNLQSIVRAAMTQAVASEQRMGASLLRLFFHDCFVQGCDGSILLDAGGEKTAGPNLNSVRGFEVIDTIKRNVEAACPGVVSCADILALAARDGTNLLGGPTWSVPLGRRDSTTASASLANSNLPPPTASLGTLISLFGRQGLSPRDMTALSGAHTIGQARCTTFRGRIYGDTDINASFAALRQQTCPRSGGDGNLAPIDVQTPVRFDTAYFTNLLSRRGLFHSDQELFNGGSQDALVRQYSASASLFNADFVAAMIRMGNVGVLTGTAGQIRRNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 2, introns 1 and 2) and 18 ESTs. Also found in AC145452.7 (28174-29350). Cultivar="B73" and "Hybrid 35A19".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTCCCACCTTGATGCAATGCCTGGTCGCCGTTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGCCCACGTTCTATGCGTCCTCCTGCCCCAACCTGCAGAGCATCGTT
CGGGCGGCGATGACCCAGGCCGTCGCAAGTGAGCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTCGTTCAA
GTATACTAGCTAGAATCCTCACACTATTATATA
TTCTTATAACAGCTAGCTAACAACACACAGCTCAATAATTTGACTGCGATGCATCATGACATGTGTATGCGACGGTGATGCATGATGACAGGGCTGCGACGGATCGATCCTTCTCGACGC
CGGAGGGGAGAAGACCGCCGGGCCGAACCTGAACTCGGTGCGCGGCTTTGAGGTCATCGACACCATCAAGCGGAACGTCGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCT
CGCGCTTGCCGCGCGCGACGGAACCAACCTT
GTACGCACGCGCGCGCCTTCTAGCTAGTTTGCATGGACGGTCAAACCGCTCGCGTCGTCGATCGTCTGACACTTTTCCTTTGCTTCGTT
GTGCATCTCCGTACGTTACGTATAGCTCGGCGGGCCGACCTGGAGCGTGCCGCTCGGGCGGCGGGACTCGACGACGGCCAGCGCCTCGCTCGCCAACAGCAACCTCCCGCCCCCGACGGC
CAGCCTCGGCACGCTCATCTCCCTGTTCGGCAGGCAGGGCCTGTCGCCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCATCGGGCAGGCCCGGTGCACCACCTTCCGCGGCCGCAT
CTACGGCGACACCGACATCAACGCCTCCTTCGCGGCGCTGCGGCAGCAGACGTGCCCGCGGTCCGGCGGCGACGGCAACCTGGCGCCCATCGACGTGCAGACGCCGGTGAGGTTCGACAC
GGCCTACTTCACCAACCTGCTGTCGCGGAGGGGCCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAGCGCCTCGCTCTTCAA
CGCCGACTTCGTGGCAGCCATGATTAGGATGGGCAACGTTGGGGTGCTCACCGGCACCGCTGGACAGATCAGGCGCAACTGCCGGGTCGTCAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTCCCACCTTGATGCAATGCCTGGTCGCCGTTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGCCCACGTTCTATGCGTCCTCCTGCCCCAACCTGCAGAGCATCGTT
CGGGCGGCGATGACCCAGGCCGTCGCAAGTGAGCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTCGTTCAA
GGCTGCGACGGATCGATCCTTCTCGACGCCGGA
GGGGAGAAGACCGCCGGGCCGAACCTGAACTCGGTGCGCGGCTTTGAGGTCATCGACACCATCAAGCGGAACGTCGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCTCGCG
CTTGCCGCGCGCGACGGAACCAACCTT
CTCGGCGGGCCGACCTGGAGCGTGCCGCTCGGGCGGCGGGACTCGACGACGGCCAGCGCCTCGCTCGCCAACAGCAACCTCCCGCCCCCGACG
GCCAGCCTCGGCACGCTCATCTCCCTGTTCGGCAGGCAGGGCCTGTCGCCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCATCGGGCAGGCCCGGTGCACCACCTTCCGCGGCCGC
ATCTACGGCGACACCGACATCAACGCCTCCTTCGCGGCGCTGCGGCAGCAGACGTGCCCGCGGTCCGGCGGCGACGGCAACCTGGCGCCCATCGACGTGCAGACGCCGGTGAGGTTCGAC
ACGGCCTACTTCACCAACCTGCTGTCGCGGAGGGGCCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAGCGCCTCGCTCTTC
AACGCCGACTTCGTGGCAGCCATGATTAGGATGGGCAACGTTGGGGTGCTCACCGGCACCGCTGGACAGATCAGGCGCAACTGCCGGGTCGTCAACAGCTAG

Retrieve as FASTA