Entry information : OsPrx106-2 (Os07g4449 / OsPrx106-2)
Entry ID 7443
Creation 2010-07-16 (Christophe Dunand)
Last sequence changes 2010-07-16 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-05 (Qiang Li)
Peroxidase information: OsPrx106-2 (Os07g4449 / OsPrx106-2)
Name (synonym) OsPrx106-2 (Os07g4449 / OsPrx106-2)
Class Class III peroxidase    [Orthogroup: Prx231]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx106-2
start..stop
S start..stop
OsPrx106-1 644 0 1..384 1..384
SbPrx44 391 4e-136 90..384 50..349
HvPrx19 388 2e-135 80..384 15..326
SiPrx141 388 9e-135 66..384 38..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26513728..26514135 408 N° 2 26525534..26526280 747  
join(26513728..26514135,26525534..26526280)


exon

Literature and cross-references OsPrx106-2 (Os07g4449 / OsPrx106-2)
EST ref. GenBank:   CI175268.1 [3' end]
Protein sequence: OsPrx106-2 (Os07g4449 / OsPrx106-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (365)
PWM (Da):   %s   40151.15 (38254.0)  
PI (pH):   %s   7.22 (6.74) Peptide Signal:   %s   cut: 20 range:20-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLAVLLTLLALVGSVTCQGYTGNASPPTPITYPSPPSLSPSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNPAPTSPSPPAPGLRVGYYSSSCPKAEQIVKDTVKNAVYANRGIGAGLVRLFFHDCFVEGCDASVLLDPTTANSRPEKLGVPNFPSLRGFEVIDAAKAALESACPGVVSCADVVAFAGRDAAYFLSNANIDFAMPAGRYDGRVSLADETLTNLPSPFAGLDQLKKNFADKGLDADDMVTLSGAHSIGVSHCSSFSDRLASTTSDMDAALKANLTRACNRTGDPTVVQDLKTPDKLDNQYYRNVLSRDVLFTSDAALRSSETGFSVFLNVVIPGRWESKFAAAMVKMGGIGIKTSANGEIRKNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1) and one EST. Inverse tandem duplication of OsPrx106-1. Cultivar="Nipponbare".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGCTTGCTGTGCTGCTCACATTGCTGGCTCTGGTCGGTTCCGTGACATGCCAAGGCTATACCGGCAATGCTAGCCCACCCACACCCATTACATACCCAAGCCCGCCAAGCCTG
AGCCCGAGCATGCCGCCTACTTATCCTCCACCTAGCTCGACTCCTCCGAGTCCAGCACCGGTGAGCCCGAGCCCGCCAACAACCTATCCTCCACCAAGCACAACTCCTCCGAACCCGGCT
CCAACCAGCCCAAGCCCGCCGGCCCCGGGGCTTAGAGTTGGTTATTACAGTTCCTCTTGCCCAAAAGCTGAGCAAATTGTGAAGGACACCGTCAAGAACGCTGTGTACGCCAACCGCGGC
ATCGGCGCAGGGCTCGTCCGCCTCTTCTTTCATGACTGCTTCGTCGAG
GTAAAAAAAAATGTTTTCTTATTAATTAATGTGGAGATTATGGGTATCCCATATCTACACGGCGATGGTATT
CGAACTGGGTACCGGATACTTAATGTAGATAGAATATCTTATCTGTATCTCGGGTTTGTTTCTTAACTTGTGTATCAAGGAAACACCCTGAGACTTAGTCGGTTACGACTGTATTTTACC
TCTATCTTCATATTCCGTTAGGAATATAGATTATCTTTTGTAATCCGGACTCCTTCCAGTATATAAAGGGGGTCCGGGCGCCTCTAGGGATATATGCTGATTTTTCCCGAATCATACAAT
CAATAATACACTCGGCGGATTCATCCCCGGACAGGAGTAGGGTATTACTTCTTTTATAAGAAGGCCTGAACCTGTATAAATCCTTTGTCTCCAAACCCATACACTTTCCGAGCTTGATAG
CCACCCCCTTTTATTATTGCCGAAATCTAGTTTCGACAGTTGGCGCGCCAGGTAGGGGTAGCGTCAAGCTTTTCGCCGATCAGTGCAATGGGTCCCATCTCCGGCATCGACGACCTCGTC
TTCCCTCCCGGGCAGACGTTTCGGTTCGGCAGCCTCGACTTCATCACCAACAACTTCGGCAAGATTTCTCTCCTTGACTCGGAATCGGACCAGTCGGGAGAGAACCGGCTTTCGGTCCCG
TTTGGATTCCCGAACGCGGCTGAAAGCTACTTCCAGACCATCTCAACCGAGTCGGCTTCAAACCACTCGGCTGAGATCGCATCTTTTCCAACGATACCAGATCAAGATGATGGGGCTTAC
CCACCGGTCCTGATGAAGCTCCCCGACGATTTAGCGGCCGTCTTCACCACGACAGCGCCTTCATCCCGTAGGCCTAGGCGGAAGTCGGCTTCAACACCGATTTCGCCTAGCTTCAGGGAA
GTCGGCGTCATCCTCCAACCACTCGGCACGGTTTCGACAGATCAGCTGGATGACTACAACAGCTCTCCCACCGTCGACTCACGTCCTACTGACATCGTGGAGTACGATGAGTTTAGCTCT
CGCTACCACGACCCGGATCTCGACGACTTCGACGGAAGCCTAGATGACAACTACACCCCTCTCTACTTTGGCGTTTTCATGGCCAATAACGAGACGGAGGAGCAACGCCAAGCCCGGGAG
ACCGAAGAGCGTCGCCGACTGGAGGAGGAGCACCAAGCACAAGAACAAGAACGGCTACGGCGCGAGCAGCAGGACCGTGAACGGATCGCGAAGGAGGCTGAAGATCGACGTCAGCGAGCT
TTGGAAGCAGGGCGCCGAGCGCGTGATCTCATCGGCCAGCAAGATGTCGAAGGGACACCGGTTTTCCGCACCCCTCAACAGAATGCGGTTGCCGCGATCACCCTTCTCGACACCCTCCTC
AACCAAAACGAGCTCAATCGATCCGACCACGTCGTCAACATCCTGAACCAGACAAAGACCATGATTGCGGCGACGGTCCCAGTTAACTCCGAAAGCGTCCACACGCCGACTGGCAGCCGG
GTCCCCCACTTCCGATCTCATGACTACCGTCATCCAAGCCTCAGCATCACCGGAGCAGGATCCAATCGCAGGAGCAGGGGCCACGACGAGCGGTCTGTTCACTCGCCTCCCGAACTTCAT
AGGGAGCGCCGAGTGGAACGGCCTCGCTCACCACCTCGTCGCCGCCCCATCGATCTTCGCGACACAATCACACAGCGCCGAGCAGCTCGAGGCTACCATCACTCGCCGGATCGCCGCGAC
GACGACCTTGACGGAGTTGCAGCCTTCACCGACGACCTGCGTCGAGTGGATTGGCCAGCCGGCTTCAAACCGACTGGAATAGAGAAGTACGACGGTACCACTAATCCAGAATCGTGGCTT
ACCGTCTACGGTCTCGCAATCCGCGCAGCAGGAGGAGATAACAAGGCCATGGCGAACTATTTACCGGTGGCTTTAGCAGATTCCGCCCGATCTTGGCTCCATGGATTGCCCCGTGGTACA
ATTGGATCTTGGGCCGAACTACGCGACCACTTCATCGCCAACTTCCAAGGCACCTTCGAGCGTCCCGGCACACAATATGATCTTTACAACGTCATTCAGAAGTCCGGAGAATCTCTTCGA
GATTACATTCAGCGATTTTCTGAACAACGTAACAAGATCTCCGACATCACCGACGACGTCATCATCGCCGCATTCACCAAAGGGATTCGCCACGAAGAATTGGTCGGCAAATTCGGGCGC
AAACCTCCCAGAACAGTCAAGCTCATGTTTGAAAAAGCCAACGAGTACGCCAAAGCCGAAGACGCCGTCACCGCATCGAAGCAGTCGGGTCCCAGTTGGAAGCCGAAAAATACGCCGGCT
ACGGGAGGAGGTGGAAGTAACAATCATAAGGACCGCAAGCGTAAGCCTGAGGAACTTGTTGCAACCGCCGCTCACTCTTCTCGACAGCGTTCGCGCGTCAACACCTTCGACAAGATCATG
AACTCCCAATGCCCGCATCATCCAAACTCCAACCACGTGGCCAAAGAGTGCTTCATCTACAAACAGTTCGCGGAGCAGTACACCAAGTCTACTCGGAAGAACTCCGACGAAGAACAAAGC
ACGTCAAGGAAGCAGGATGACGGCGACACCCCGGCTGGATTTCAAGACCACCGCAAGGAGCTTAACCATATCTTCGGCGGCCCCCTGGCTTACGAATCTAAACGGAAGCAGAAGTTGACT
GAACGGGAGATCAATGCTGTTCAACCTGACACGCCCCAGTATCTTCGATGGTCAGAAATCGCAATCAAGTTTGACCGCTCGGATCATCCTGACCGAGTGGTCCACCCGGGGCGGTACCCC
CTGGTACTAGACCCAGTGGTCCGTAATGTCAAGCTTCGCAGAACCCTCATTGATGGCGGCAGTGCACTCAATATCCTCTTCGCCAAGACTTTGGATGATATGCAGATCCCTCGCTCCGAG
TTAAAACCAAGCAATGCGCCTTTTCATGGAGTAATTCCAGGATTATCCGCAACTCCACTCGGCCAGATTACTCTTCCGGTCACTTTTGGCACTCGGGAAAACTTCCGCACAGAGAATATC
AGCTTTGAAGTTGCCGATTTCGAGACAGCATACCACGCCATACTCGGACGCCCGGCGTTAGCCAAGTTCATGGCCGTCCCGCACTACACTTACATGATGATGAAGATGCCTAGTCCCCGA
GGAGTCCTATCCCTACGGAGCGACATCAAGCAAGCCGTCACATGCGACAAGGAGAGTTGCGACATGGCCCAAACTCGCGAGATGGCGCTAGCCCGAGAGGAAATCCGACTGGCTGCAACC
ACGGTGAGCGAAGGAGAAGTGCCCGCTGCCAAGACTTCAAAAAGTGGGGAAACCGAAGCCGCGACTAAAAAGATTCCCTTAGATCCTTCTGATCCTACCAAAACTGCTGTAATAGGCGCC
GAGTTAGATTGTAAATAGGAAAGCGCGCTCATCACCTTTCTTCAAAATAATAAAGATATCTTTGCGTGGAAACCTTCGGATATGCCCGGTATTCCCAGAGAGGTGATTGAGCACTCCTTA
CATGTCAAAGAAGACGCCAAGCCTATTAAACAACGACTTCGCCGATTTGCACAAGACAGGAAGGACGCGATCAAGGAGGAATTGACCAAGCTGTTAGCAGCAGGCTTCATCAAAGAAGTC
CTTCATCCCGACTGGCTGGCAAACCCGGTTCTAGTTCGGAAGAAAACAGGGCAATGGCGCATGTGTGTTGATTACACTGACCTCAACAAGTCTTGCCCTAAAGATCCCTTCGGGTTGCCT
CGCATTGACCAGGTAGTTGACTCAACCGCCGGCTGCGAGCTCCTCAGTTTTCTGGATTGCTACTCGGGGTATCATCAGATCCGACTGAAGGAATCCGACTGCTTGAAGACTTCATTCATC
ACGCCTTTTGGGGCATACTGCTACGTCACCATGCCGTTTGGATTAAAAAACGCAGGAGCAACCTATCAACGCATGATCCAGAGATGCTTTTCAACACAGATCGGCCGCAACGTTGAAGCC
TATGTGGATGACGTAGTCGTCAAGACCAAGCAAAAGGATGATCTGATCTTGGATCTAGAAGAAACCTTCGCGAGCATCCGCGCCTTCAGAATGAAATTGAACCCTGAAAAGTGCACCTTC
GGAGTACCGTCAGGGAAGCTGCTTGGCTTTATGGTGTCTCATAGGGGCATCCAAGCCAACCCGGAGAAAGTTACTGCTATCCTCAACATGAAACCGCCAAGCACCCAGAAAGATGTTCAG
AAGCTGACTGGATGCATGGCGGCGCTCAGCCGATTCGTTTCAAGACTTGGCGAGCGGGGGATGCCCTTCTTCAAGCTACTGAAGAAAACAGATAATTTCCAATGGGGACCTGAAGCACAG
AAGGCCTTCGAAGATTTCAAACAACTCCTCACCAAGCCACCGGTCTTAGCCTCACCACATCCGCAGGAGCCGTTGTTGCTGTATGTATCAGCCACCTCCCAGGTCGTGAGCACAGTCTTG
GTTGTCGAGCGTGAGGAAGAAGGCCATGTCCAGAAAGTTCAGCGACCAATCTACTTCGTCAGCGAGGTCCTGGCCGACTCCAAAACGAGGTACCCTCAGGTTCAGAAGCTGTTATATGGT
ATTTTAATTACTACCAGGAAGCTGTCTCATTACTTTCAAGGTCACTCGGTAACGGTGGTCACATCATTCCCACTCGGCGACGTACTACACAACCGCGAAGCAAATGGGCGGATTGCTAAG
TGGGCTTTGGAGTTGATGTCTTTGGACATATCATTCAAGCCCCGCACTTCAATCAAGTCTCAAGCGTTAGCCGATTTTGTCGCCGAGTGGACCGAGTGCCAAGAGGATACCCCCGTGGAG
AAAATAGAGCACTGGACCATGCATTTTGACGGGTCAAAAAGACTTTCAGGCACTGGAGCTGGAGTGGTTTTAATTTCCCCGACTGGAGAAAGACTAAGTTATGTGCTTTGGATACATTTT
TCGGCGTCCCACAACGTCGCCGAGTATGAGGCGCTCCTTCATGGGCTACGGATTGCAATTTCCCTAGGGATAAAGCGTCTAATCGTTCGAGGTGATTCACAACTGGTTGTCAACCAAGTT
ATGAAAGAGTGGTCTTGCATTGACGACAACATGATGGCATATCGACAAGAGGTACGCAAACTGGAGGATAAGTTCGATGGACTTGAGCTCAGCCATGTTCTTCGACACAACAATGAAGCT
GCCGATAGACTTGCGAACTTTGGATCCAAGCGCGAGGCGGCGCCCTCTGATGTTTTTGTCGAACACATTTATACGCCGACGGTACCTCACAAAGATGCCACTCAAATTACGGGCACCCAT
GATGTCGCTATGGTTGAAGCCGACTGGCGAGAGCCCTTCATACGATTTTTAACTTCTCAAGAGCTCCCTCAAGATAAAGATGAAGCCGAGCGGATTTCAAGGCGGAGCAAACTTTATGTT
ATGCATGAATCTGAGTTATACAAGAAAAGCCCTTCAGGAATTCTGCAACGCTGCGTATCTTTAGAGGAAGGGAGACAATTGCTGAAAGACATACATTCTGGGATATGCGGAAACCACGCT
GCTGCGCGCACCATTGTCGGCAAAGCTTACCGGCAGGGTTTTTTCTGGCCTACTGCAGTGTCCGACGCCGACAAAATTGTGCGCACATGTGAAGGTTGCCAATTTTTCGCCAGACAAATT
CACTTACCAGCTCAAGAGTTGCAAACTATCCCGCTGTCTTGGCCGTTTGCGGTTTGGGGGCTCGACATGGTTGGCCCGTTTAAAAAGGCAGTCGGCGGTTACACGCACCTCTTCGTGGCC
ATCGACAAATTTTCCAAGTGGATCGAAGCTAAGCCTGTTGTCACGATTACAGCAGATAATGCTCGAGACTTCTTCATCAACATTGTGCATAGATTTGGGGTGCCCAATCGGATAATCACT
GATAATGGCACACAATTCACCGGCGGAGTTTTCAAAGACTTTTGTGAAGATTTTGGAATAAAGATTTGTTATGCCTCCGTAGCGCACCCAATGAGCAATGGACAGGTGGAGAGGGCCAAC
GGCATGATACTTCAAGGGATTAAAGCTCGAGTTTTTGACCGGCTTAAACCCTATGCCGGCAAATGGGTGTCACAGTTACCATCAGTACTTTGGTCTTTGCGTACTACGCCCAGTCGGGCC
ACAGGCCAGTCACCTTTTTTCCTTGTCTACGGGGCAGAAGCAATGTTGCCGAGTGAAGTCGAGTTCGAATCTTTGCGCTTCCGTAATTTCCGTGAAGAACGCTATGAAGAAGACCGAGTG
GACGACTTGCACCGACTGGAAGAAGTCCGCGAAGCAGCTTTGATTCAGTCAGCTCGGTACTTACAAGGGTTGCGACGTTATCATAATCGCAATGTTCGATCTCGTGCCTTTCTAGTCGGC
GACCTGGTTCTACGGAAAATTCAAACCACACGAGATCGGCACAAGTTATCTCCTCTATGGGAAGGGCCATTTATTATCTCTGAAGTTACCCGACCAGGTTCATACCGACTCAAGCGCGAA
GACGGCACTCTCGTCGACAACTCTTGGAACATTGAACATCTTCGTCGTTTCTACGCTTAACTTTATCATTGTATTTCCCTATTTTGACTGTCAACATCAAGTTTTCTTCTTGCCGTTGTC
AGTCGGGGGCTATTATCATAATAATGGAGTGTGATTTTTTATCAATTCAGTTTGCTTACTTGGTTTATCATTGCCTTGTTTGGTTTTTCTACTTAGTTTGAGAGGACTGAAAGTTTTTAA
TAGCTTCTTTGGGTTTTAGGCTCAACAAAGCTTAGCAAAAACTTTTAAGAAATCAAAAACTTTGCAAGAATCATCAAGCACAGCATAAATACACCAGTATTGTACAAATTGAGCCTCCAT
GTATTACATCCAAACTCAGTCAGAGTCAGTCCTTTCATCATCAGAGTCATCATTACTCGGCTGGAGGTCGTTGTTGCGAAATTGCTCCACAACATCACTCGCTATTTTGTCAGCCGCAGT
TTGCGCACTACCGATAAGATCAAGGGCAGCTTCTTCACTTGTCCCGTCTGCAAATCCATCAATGGTGTCGACTTCAATTCTCGGGTACAAAGATTTTGTCATCGCCAAGGCCATGCCAGC
TCCCATACTTCCAGCTTTCTTGATATTTTTGAAATATACTTCCGGAGCAACACTCAGCTTGTCAAATATTTCGGTTGCGTCGAGTGCACTCGGACCACCGTTATTGAGGAACATGGCTTG
GATAATTGGTGCAGCGGCATTGGCGACATCATCCCTTGCTCCTTCAAGCCTCTTGATCTTACCAACCAGGACGTCAAACTGAGCTTGAGATTTGATCTTGCGATCTACAAAACACATTTA
TGATGAGCATCTGTTGCATTATAAGGAGAGAAGCTCAGATTGTTGGCTGGCGTTACCTTCGACTTCCTTCAAGGCTGAGTCCCTTTGCGCAGCCAGTTCTGTCTTATCTCTCTCCAGGGC
TTCAATTTGCTTTGCCATCTGTTCCATCCTGGCGGCTTGCGCTGTTTTGAAATTCAGATGGTTGAGGATATAGTTATGCCAGTTTGAACTGATGAAACTGATCTAGAGATTACCTTTGGA
TGAACCACTCAGCTCATAATTTGACTCTTGGAGCTGAGCGATTCGGTCCCTTAATTCTTTCTCCGTCTTCTTGGCAAGCTCCTTGGTCTCATGCAGCTGGTCCCTAACTGCTTCTAGAGT
TCCCAAATGAGGAACCAGCTTTTCCAAAGTTGTGGTCTTGGCCTCATTGCGAAGATGGATTCTCTGCACGATGGATCATGGTTCAGTTCTGCTAAAAAGAAAACAAAGTTACTGAAGGCT
GTCGCTCGGAAGACTTACATTTACAATACGAGTGGCCTCTCCAAGCGCTTTCTTCAGCTGGCACACTTCTTCATCTTCTTTTTGACGGTTTATGACTATACCGGCGGCTTGTGAGTTCTC
GTCCCACCATTTGATCAAGATAGGAGGACGAGAGTCGTCGGTCGCCTTTATGCGAGGGATTTCTTCTCCGTCATCACCTGATGGTCCTGATGTGTTTCCAAGACATTAGACGGATACGCT
GAGGTTATTTAAATCACCGTTGTATGAGAAGACAATTAACCTGGAGATGTACCTAGCTGAGCGTGAGGTGATCTTTGTTCTTTGCCTGGAGATCCAGCTATTGAGTCATTACCAGCTTCT
GGCCCTTGGGAAGCTGTCGTCTGCGCTTCTACTTCAGGGATTTCTTGATCAGGGCCTGCGTCCGACTGGTTTCCAGTCGGGGGCTCTTGAGTTGTTGCTGCTTCAGTTGTTGCCGACTGG
TTTCCAGTCGGCGGCTGGTCACTCGGATTGGCCTGGTCACCCGAAGCATGGGCGCCGGTCGGCTGGCTTTTGGCAGTCGGCTGGCTTTCGGCAGTTGGCTCGGGGTCTTTGGATATATTT
TGCTCTGCCATGGCTGGATCGGGGTCTTTTCCAGATGGATCTATATCAGATGGTTTCCTGCAAAGTATTCTTTCAGAATTTAGCATCATTCTCATGAGAGAGCTTACCAAAGTGAAATCA
TACCGAGAGGTCTTATACCTGGAAGATGTTCTAATTTTTGGCATTGCGCGGCCGGCCAGTTTTTTCCTGGGCATGGTGCGTTTTGGGGGTTTATTAGGCGAGCCCTTATCCCCAGATTTA
TCATCGTCGCCTTCATCGTCATCAAGCACCAGTTTCCTCTTGCGAGGACCCGTCTGACCAGTTGATTTGGAGGTCTGAGGTTGCGGATCCGGTCTGATCGTTGGCCCTCCACCTCCCTGA
GCGGTATGTTGACGAGGAGACCGGCGCTGAGTGACTGGTGGATCTGACTTCATCAGTGTATATTCCTGAACAAGATGCTTCCATAGTTAGTCAACTCAGCATGAAGACAAAATTATGTTC
TGATCATGGTTTGAGGATTTCCAATACATACCTGCGGAGGCGGATTGAATGCATTGTATGGCACGACTGGCAGCTGGTGTGAGTAGCTGACGACGATTGCATTTGAGAAGATTTTATACA
TCCTCTCCTTCATGATTCTGAAATCCAGAGAGTCTGATTCTTCACGGTTAGGATCATACTTGCCGTCAAACTCGAATGCCGTGCGAGATCTTTCCTTGATTGGCGCTAGTCGGCATTTGA
TGAAGTGCCGAGTAATCTGCTCTCCTTGCAAGCCTTGCTCTTTAAGCTTTAACATGCGATCCAACAATTCCAAGGCTTGGACTGCTTCATCTCCAATTGGAAGAGAGTTCCAGGTATCTT
GGTATACTGGAGGAAGACAAGAGTACCCGGGAAGAGCAGGCTCAGGATTTTGGACATAGAACCAGTTTGCGTGCCAGCCTTTGTTCGAAGTCTTGAAGGGCATGGAGAAATATTTTTGGC
TCAGAGTTCCCCTCAGTTGGAATCCTGCCCCCCCGACTACACACGGTTTGTTCTTGTTTGGTTGGGGCTTGAGGAAAAAGATCCGGCGGAATAGGGCAAAGTGAGGCTTGATCCCCAAAA
AGGCTTCACAAGCATGGACGAAATTGGCAATATGTACGATGGAATTCGGGTTTAGGTGATGTAAGCTGATTCCATAGAAGTTCAAGATCCCACGGAAAAATCTTGAGGTCGGAAGAGCAA
AACCACCGTAGAAGAAATGCGAGAAGACTACAATTTCATGCGTATCTGGAGATGGAAATGCCTCACCGTACGCTGGCCGCCACCCGATGATCTCTTTGGCTGGGAGAACACCGTGCGCCA
CCATCTCCTTCAGATTCTCCTCTGTCACATCGGACGCCGCCCATTGGCCTTCAAAGCTTTCTCTCTCTTCCGCCATCGATTTTTCTCAAATGTGCTGGTTTGATTCGAGGGATGGCTTGG
GAGAGGTGAGGAATTGAGGCGGTGGATCACGGGAAGGATTTTGATGCGTTTTTCGGAGGTGGATTTGGCCGGAGTTGTGAACCCTAGTTCGCCGGCGCAGCTTTTCACTGTAGCAAGGAG
TGGGGAAAATGGCGAGAGTTCCGGCGGGGAAGACGAAGCGTCGCTTGGATATAGGATTTTTCAGTTAAGGGTATCGGAGGTGCTAATGGGCCTAGGCCTGCACAGTACTTCAGCCCAATA
CTTTTAACAGCGTGGCCCATTGTGTTCCTTAGGGACTTAGGCATATTTTGCTTTGGCAATATTATGCGCACAACAGTGTTGCCCAATGCTGATCAAATCCTTTTTATGCGGTCATATAAT
TCTTTGGAATTATTGCAATGCAAATTAAAAAGGTGCCCGACAGAAAGGCGTCATGCTGTTTTTGCAAGCTTTTTTAGGCTACAAAAGCTGTTTGGGTTAACTAGGAATGACTTGTTTTTA
TTATAGTCATTTCCTTGGCGTGTTATATGCCTATTTTCATGGTAAATAGTCATGGCCTAGGCTATTTGACTTATTTATTACCATAATCTTTATAATACTTGATGGGTAATCTTTAGAATT
TTTTTATTCGGATGCCTGTCAAGTGTGTTCATTCGTGAACCTTTTAGAGTGTAAACCACTCGGATTTCTTTTATGGTGGCTAAAAAGCAGTCGGCTAGTATGCCTATTTAGGCGCCGCGT
ATGCTTTTGTCATATAATGCACAATTGTGTTATTATTTTGTCTTTCAACTATATGTTTAGTTTATTAACTAATCACATAGTTGGGGGCTACACCTAATTAGGTGCATCTATTCGATGCAC
CATATTCTTTATTTTTTTCGCCCTTTACAGTCCACTCGGCAGATTTTGGCTTGAAGAGTTTGAAGTACTCGGATTATTATCTTTGAGAAGACTATGATGGTCGACTGCAAAGGACTCGGG
GGCTACTGTGGAGATTATGGGTATCCCATATCTACACGGCGATGGTATTCGAACTGGGTACCGGATACTTAATGTAGATAGAATATCTTATCTGTATCTCGGGTTTGTTTCTTAACTTGT
GTATCAAGGAAACACCCTGAGACTTAGTCGGTTACGACTGTATTTTACCTCTATCTTCATATTCCGTTAGGAATATAGATTATCTTTTGTAATCCGGACTCCTTCCAGTATATAAAGGGG
GTCCGGGCGCCTCTAGGGATATATGCTGATTTTTCCCGAATCATACAATCAATAATACACTCGGCGGATTCATCCCCGGACAGGAGTAGGGTATTACTTCTTTTATAAGAAGGCCTGAAC
CTGTATAAATCCTTTGTCTCCAAACCCATACACTTTCCGAGCTTGATAGCCACCCCCTTTTATTATTGCCGAAATCTAGTTTCGACAATTAAAACACGTGATTAATAATTAGTTAGTAAT
CCACGTGATTAATGTGGCTGTGTATTGTCTCCTTTCGATTGATCAGGGCTGCGACGCCTCCGTTCTGCTCGACCCGACGACGGCGAACTCGCGGCCGGAGAAGCTCGGCGTGCCCAACTT
CCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCGGCGAAGGCGGCGCTCGAGAGCGCGTGCCCCGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCGCCGGCCGCGACGCCGCCTACTT
CCTCAGCAACGCCAACATCGACTTCGCCATGCCGGCCGGCCGCTACGACGGGCGCGTCTCCCTCGCCGACGAGACCCTCACCAACCTGCCGTCGCCGTTCGCCGGGCTCGACCAGCTCAA
GAAGAACTTCGCCGACAAGGGGCTCGACGCCGACGACATGGTCACCCTCTCCGGCGCGCACTCCATCGGCGTCTCCCACTGCTCCTCCTTCTCCGACCGCCTCGCCTCCACCACCTCCGA
CATGGACGCCGCGCTCAAGGCCAACCTGACGCGGGCGTGCAACCGCACCGGCGACCCCACGGTGGTGCAGGACCTCAAAACCCCCGACAAGCTGGACAACCAGTACTACCGGAACGTGCT
CAGCCGCGACGTGCTCTTCACGTCGGACGCGGCGCTCCGGTCGTCGGAGACGGGGTTCAGCGTGTTCCTCAACGTGGTCATTCCCGGCCGGTGGGAGAGCAAGTTCGCGGCGGCGATGGT
GAAGATGGGCGGCATTGGAATCAAGACCAGCGCCAATGGCGAGATCAGGAAGAACTGCCGCCTCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGCTTGCTGTGCTGCTCACATTGCTGGCTCTGGTCGGTTCCGTGACATGCCAAGGCTATACCGGCAATGCTAGCCCACCCACACCCATTACATACCCAAGCCCGCCAAGCCTG
AGCCCGAGCATGCCGCCTACTTATCCTCCACCTAGCTCGACTCCTCCGAGTCCAGCACCGGTGAGCCCGAGCCCGCCAACAACCTATCCTCCACCAAGCACAACTCCTCCGAACCCGGCT
CCAACCAGCCCAAGCCCGCCGGCCCCGGGGCTTAGAGTTGGTTATTACAGTTCCTCTTGCCCAAAAGCTGAGCAAATTGTGAAGGACACCGTCAAGAACGCTGTGTACGCCAACCGCGGC
ATCGGCGCAGGGCTCGTCCGCCTCTTCTTTCATGACTGCTTCGTCGAG
GGCTGCGACGCCTCCGTTCTGCTCGACCCGACGACGGCGAACTCGCGGCCGGAGAAGCTCGGCGTGCCCAAC
TTCCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCGGCGAAGGCGGCGCTCGAGAGCGCGTGCCCCGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCGCCGGCCGCGACGCCGCCTAC
TTCCTCAGCAACGCCAACATCGACTTCGCCATGCCGGCCGGCCGCTACGACGGGCGCGTCTCCCTCGCCGACGAGACCCTCACCAACCTGCCGTCGCCGTTCGCCGGGCTCGACCAGCTC
AAGAAGAACTTCGCCGACAAGGGGCTCGACGCCGACGACATGGTCACCCTCTCCGGCGCGCACTCCATCGGCGTCTCCCACTGCTCCTCCTTCTCCGACCGCCTCGCCTCCACCACCTCC
GACATGGACGCCGCGCTCAAGGCCAACCTGACGCGGGCGTGCAACCGCACCGGCGACCCCACGGTGGTGCAGGACCTCAAAACCCCCGACAAGCTGGACAACCAGTACTACCGGAACGTG
CTCAGCCGCGACGTGCTCTTCACGTCGGACGCGGCGCTCCGGTCGTCGGAGACGGGGTTCAGCGTGTTCCTCAACGTGGTCATTCCCGGCCGGTGGGAGAGCAAGTTCGCGGCGGCGATG
GTGAAGATGGGCGGCATTGGAATCAAGACCAGCGCCAATGGCGAGATCAGGAAGAACTGCCGCCTCGTCAACTAG

Retrieve as FASTA