Entry information : OsPrx1617 (Os01g0378100 / OsPrx16-17)
Entry ID 7446
Creation 2010-07-16 (Christophe Dunand)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: OsPrx1617 (Os01g0378100 / OsPrx16-17)
Name (synonym) OsPrx1617 (Os01g0378100 / OsPrx16-17)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Flowers
Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx1617
start..stop
S start..stop
BdiPrx68 571 0 7..342 4..338
TaPrx05-1A 567 0 1..342 1..343
AcoPrx32 399 2e-140 19..342 11..326
AcoPrx116 399 2e-140 19..342 11..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15907915..15908162 248 N° 2 15906924..15907283 360 N° 3 15904947..15905072 126 N° 4 15904476..15904783 308
complement(join(15904476..15904783,15904947..15905072,15906924..15907283,1590791 5..15908162))


exon

Literature and cross-references OsPrx1617 (Os01g0378100 / OsPrx16-17)
DNA ref. GenBank:   NC_008394.4 (15908162..15904476)
Cluster/Prediction ref. UniGene:   Os.79263
Protein sequence: OsPrx1617 (Os01g0378100 / OsPrx16-17)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (318)
PWM (Da):   %s   36328.4 (34017.2) Transmb domain:   %s   i9-31o
PI (pH):   %s   8.32 (8.21) Peptide Signal:   %s   cut: 25 range:25-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQGGANNKGLVCLIAAAAVVLVFAGSSGIAAAQAARAEEGVLQEELPQGGGDRAAGGVEPRRRQPGARRQVPPHVLPRLLRQGGVTRRCFWTRLATRRRRTRRRTCRWRGSR*SRR*RRRWSGSAPGWCRARTSWRWRRGTRCRTSTGGACGRWRPGGVTARSPATRRRSPTSRRPPPPSPSSSPTSPPRASVSRTSSSSQVRRAHHRNRALQPFQL*ALQLHRKEQPQRRRPVPQPILRQIPPGAGAVQA*PAGPKRQLDGGADGPGQQRVVRQPLLREPQGAAGDVHLRRHAAHRRPRRRARRQAAGPRRLPRPLQELHQAHGPDRRAHRRRRPDQEEVQRRQX

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, introns 1, 3 and 3'). Incorrect predcition from Phytozome (large part of the exon 1 is missing due to a frame shift corrected with ESTs from indica). Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGGAGGCGCCAATAATAAGGGCTTGGTATGCTTGATCGCCGCCGCCGCCGTGGTGTTGGTATTCGCCGGCAGCAGCGGCATTGCGGCGGCGCAGGCGGCCCGGGCTGAAGAAGGG
GTTCTACAAGAAGAGCTGCCCCAAGGCGGAGGAGATCGCGCAGCGGGTGGTGTGGAACCGCGTCGCCGGCAACCCGGAGCTCGCCGCCAAGTTCCTCCGCATGTTCTTCCACGACTGCTT
CGTCAGGG
TACGCACACAAATTGAATATATCCATATACTGGCCAATCATATATATATTCCCCTCTGTAGATTATAGGTTTGACTGATTAAAGTTAAACTGCTTCAAATTTAATTAATTTT
GTAGACATATATATAGGATGTGTTTTTCCCCTTTTTCCCAACTCACATCTCTCGTTTTCCACGCGCACGCTTTTCAAACTGTTAAACTGTATGTTTTTTTTTACAAAAAAAAATATATAC
AAAAGTTGTTTAAAAAAATCATATTAATCTATTTTTTAAAAAATAGTTAATACTTAATTAATCATGTAATAATACGTGCTTCGCTTGGGAGGAGAGGTTCCCAACCCCTTCTCCCGAACA
CAACCATAGTAATATTTACAACACCAAATTAGTTTCATTAAATCGATAATTAAATATATTTCTTAATATATTTGTCTAAATTAGTTTTAGATCGATAATTGAATATATTTTTATGATATA
TTTGTTTTGTGTTAAAAATGTTTTTATTTTTTTTTAAACTTGGCCGAATTTGAAAGTCAGAACAAGTTATAATCTGAAGCAGAGAGAGTATATCCAAACGATACACCATGCACAATTGTA
TTCTTGATGTGTGCAAATGGATATATAATGTACATGAAGGGGTGTGACGCGTCGGTGCTTCTGGACTCGGCTAGCAACACGGCGGAGAAGAACGCGGCGCCGAACCTGTCGCTGGCGGGG
TTCGAGGTGATCGAGGAGGTGAAGGCGGCGGTGGAGCGGGAGTGCGCCGGGGTGGTGTCGTGCGCGGACATCGTGGCGCTGGCGGCGCGGGACTCGGTGTCGTACCAGTACAGGAGGAGC
CTGTGGGAGGTGGAGACCGGGAGGCGTGACGGCACGGTCTCCAGCGACCAGGAGGCGCTCGCCGACATCCCGGCGCCCACCTCCACCTTCCCCATCCTCCTCGCCAACTTCTCCGCCAAG
GGCCTCGGTCTCCAGGACCTCGTCGTCCTCTCAGGTACG
TACACAATTTCTTGCATTGCTTGCATCGATCACTGAAGAAGTATACGTACGGAGACTAATTATTTTCTTAGATAATGGGCA
GTTCATTAAGACTGTGTTCGGCAGTGCAGGATGGGAACCCATTTTTTTTACACGCAAAACGGAGTGGTCTTTTAACATGATTAATTAAGTATTAGCTATTTTTTTTAAAAAAAGATCAAT
TTGATTGCTTAAAGCAACTTTCGCAATAAATTTTTTTTAAAAAAAACACACTGTTTAGTAGTTTGAAAAGTGTGCACGTGAAAAACGAGAGATTTGGGTTGGGAAGATGGGGTGCCGAAC
TCAGCCTAAGTACATTCATGAAAGCATCCGTTTTCTGAACAAAACTGATGAACTCGACCAAAACACAACGACGCACACGGAAGAAGAATAAAAGAACAGTACCGGCCGGTACTCCCCCTA
TTACATCTTAACTTGAACAAACTCATTAGCTAAGTCCAAGATGGTTACGCCATCCAAAATTAGACCACAAAGCACAGGGACAACTAATCATTGGGGTTGATTTCTTGATTTATCACTTCA
GCAGTATCAAAATTGTTTAACTAGCTAGGGCCTATTTTGTTTATTTGTATATGCCTAGTATTAGCCTGTAATATGTTTTCCAAGTTGTCCTAGTGACCTAGTTCACGACATTTCTCAAGA
AAAATTCTACTTTGACATTTCTTAATGCAAAAAGGGAAATAATTTTACCATCTTTGTAAAGGTAAAAAAGATAACATATTTTCGAATTGTAAAATTTGGTATCTACTAATATCTCAAGGT
ATTAAAGTTTTTAGTTTAAAATCTTGATACATTTAGTTACTTTCTCAAGTAAAGTAAAATTTGTAAAAAGAAAAAGAAAACCGTCCATATGAAAGGTTGCATGGATTTGAATTGAAGCAT
GTTGATTAAAGACAACTGTTCCCGTAGTGTGAAAACAACCGCTTGATTGCAATAGCCCAGCTGAAAATGACATAATTGTCGGTGATGGGGCAAAGAATTAATTAAACTTCACCACAGGCC
ACATGCACGTCCGGTTAATGCGCATGTGAGCCAAAACAGTATACGAAGATGCAACCACCAGATTGGATAGATTTAGCTTCAATTCGGTAGGTAAAAAAAAAACAATCCTTGGGAAAGTAA
TCCCAGTCAAGATAGCAGCTTTAGGAATTAAAAAAATTCAAATCAAACGTCGGATAAAAAAAATTATACCAAACATGAATGTTTTTTTATTCATATTCAACATTATTACCACAGTCCATT
TTTGGATTGTTGTAAGACGGACTACTCACCGTACTAAAGTAGGATGGATGACTGCAGTACTTAATTAGAATAGACGGTACCGCTTAGATAGCAGACAATCCTCCTAATAGCATGCGACCC
ATACTTAGAGCGCGTGAAACTCATCACATGTTATCTTGAGCGGTATGTTACTAGAAAGCGTCGGTTTCTCATCAGTGTTACTATCATACAGCTGTTCAACTTAAAAGCTACTCGCTCTGT
GGTTCGCATGGGTCGTGCCACTATCTATTGGACAAGACCCATAAACATAAATCCTTCGAATAGAATTACACAATTTTATACATATTCTCTATGTTAATATAAGTCCTTGTTTTTCGCAAA
GTAAATATTTGAAAACTAATCTTAATGAAACAAGTCAAATTTAATTTTGGAACTGATGGTACAAGAGCATGTAAGGTGGAGCAACTTAGTACATGAATATGTAAAATGATTCGTTCGATC
TATATGAACTTTTTTGGATCGTGTGGATCAAGACCAAAACAACGTACTATGACTAATTTTGTTTAGTTGAACTCTGATCGATTAATATAGGCGGGCACACCATCGGAATCGGGCACTGCA
ACCTTTTCAGCTCTAGGCTCTTCAACTTCACCGGAAAGAACAACCCCAGCGACGTCGACCCGTCCCTCAACCCATCCTACGCCAGATTCCTCCAGG
TAATTAATTAACCTGTTAATTAGT
GGAGTAATGGCTAATCTCTGCAGTAATTTAATCTCATCATGTCTTGCAAAATTCAGAATTAAGATCAGTAGCTGCAAAAAGGAAAAAAAAAAGCATAGAAAAATATGTACTACAGCAATT
GTGTGTGTGTGTGTGCAAGTGCAGGGGCAGTGCAGGCGTAACCAGCAGGACCCAAACGACAACTCGACGGTGGTGCCGATGGACCCGGGCAGCAGCGTGTCGTTCGACAGCCACTACTTC
GTGAACCTCAAGGCGCGGCAGGGGATGTTCACCTCCGACGCCACGCTGCTCACCGACGGCCGCGCCGCCGCGCTCGTCGACAAGCTGCGGGACCCCGGCGTCTTCCTCGACCACTTCAAG
AACTCCATCAAGCGCATGGGCCAGATCGGCGTGCTCACCGGCGCCGCCGGCCAGATCAGGAAGAGGTGCAACGCCGTCAACTCCTAG

Retrieve as FASTA