Entry information : OsPrx[P]97 (Os07g01380)
Entry ID 7447
Creation 2010-07-16 (Christophe Dunand)
Last sequence changes 2010-08-04 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2010-08-04 (Christophe Dunand)
Peroxidase information: OsPrx[P]97 (Os07g01380)
Name (synonym) OsPrx[P]97 (Os07g01380)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx[P]97
start..stop
S start..stop
SiPrx32 173 4e-55 1..108 55..158
SiPrx31 171 3e-54 1..108 55..158
ZmPrx90 171 4e-54 1..108 61..164
SbPrx145 170 5e-54 1..108 56..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 239496..239552 57 N° 2 239652..239945 294  
join(239496..239552,239652..239945)


exon

Literature and cross-references OsPrx[P]97 (Os07g01380)
DNA ref. GenBank:   NC_008400.1 (239496..239918)
Protein sequence: OsPrx[P]97 (Os07g01380)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   116
PWM (Da):   %s   12137.16  
PI (pH):   %s   8.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
APTLAAAILRLHFHDCFVRGCDASVLLSSTHGVGGNNMAERDAPPNRSLRGFVSVQRVKSRLEAACPSTVSCADILALMARDAVLLASGPYWPVPLGRRDGRVSCAAEVMSPSNIV*

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 1, intron 1). PS, end of exon 3 and exon 4 are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCCCCACCCTCGCCGCCGCCATCCTCAGGCTCCACTTCCACGACTGCTTCGTCAGGGTATTATACATAGATGACTTATATATATAGTAGTTTTCTTCTGCTCTAATACTAGCTACTCCG
TATATGCTGATCTGAATGCATGGATTGGGATTGCAGGGTTGCGACGCCTCCGTGCTGCTGAGCTCCACCCACGGCGTCGGCGGCAACAACATGGCCGAGCGGGACGCACCACCCAACCGG
AGCCTGCGCGGCTTCGTCTCCGTCCAAAGGGTCAAGTCCAGGCTCGAGGCCGCCTGCCCCTCCACCGTCTCCTGCGCCGACATCCTCGCCCTCATGGCCCGTGACGCTGTCCTCCTCGCC
AGTGGACCCTACTGGCCCGTTCCGCTCGGCCGGAGGGACGGCCGCGTCTCCTGCGCCGCTGAGGTTATGTCTCCATCCAATATCGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCCCCACCCTCGCCGCCGCCATCCTCAGGCTCCACTTCCACGACTGCTTCGTCAGGGGTTGCGACGCCTCCGTGCTGCTGAGCTCCACCCACGGCGTCGGCGGCAACAACATGGCCGAG
CGGGACGCACCACCCAACCGGAGCCTGCGCGGCTTCGTCTCCGTCCAAAGGGTCAAGTCCAGGCTCGAGGCCGCCTGCCCCTCCACCGTCTCCTGCGCCGACATCCTCGCCCTCATGGCC
CGTGACGCTGTCCTCCTCGCCAGTGGACCCTACTGGCCCGTTCCGCTCGGCCGGAGGGACGGCCGCGTCTCCTGCGCCGCTGAGGTTATGTCTCCATCCAATATCGTTTAG

Retrieve as FASTA