Entry information : Os2CysPrx[P]01 ( Os04g0416400)
Entry ID 7450
Creation 2010-08-04 (Christophe Dunand)
Last sequence changes 2016-02-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Achraf Jemmat
Last annotation changes 2016-02-17 (Achraf Jemmat)
Peroxidase information: Os2CysPrx[P]01 ( Os04g0416400)
Name (synonym) Os2CysPrx[P]01 ( Os04g0416400)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: N/D] N/D
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Os2CysPrx[P]01
start..stop
S start..stop
Zm2CysPrx01 339 2e-120 1..177 67..260
Zm2CysPrx02 339 2e-120 1..177 67..260
Sb2CysPrx 337 8e-120 1..177 67..260
Nt2CysPrx02-1A 336 4e-119 1..177 74..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20582596..20582664 69 N° 2 20583169..20583231 63 N° 3 20583327..20583404 78 N° 4 20585379..20585495 117
N° 5 20585709..20585822 114  
join(20582596..20582664,20583169..20583231,20583327..20583404,20585379..20585495 ,20585709..20585822)


exon

Literature and cross-references Os2CysPrx[P]01 ( Os04g0416400)
DNA ref. GenBank:   NC_008397.2 (20582596..20585822)
Protein sequence: Os2CysPrx[P]01 ( Os04g0416400)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   177
PWM (Da):   %s   19603.98  
PI (pH):   %s   4.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PLVGNKAPDFEAEAMFDQGFIKVGKKYVVLFFYPLDFTFVCPTDITAFSDRYEEFEKINTEVLGVSIDSVQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKDSKEYFASI

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (chromo 4). First exon is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGTTGGTCGGGAACAAGGCGCCGGACTTCGAGGCGGAGGCCATGTTCGACCAGGGGTTCATCAAGGTATGGCGGTAATCCGGTAACCACATGCACAGCTACATTGCGCCACGCACGCAC
GCGCGGCAGTGTTATTCGACATAGGGGATTAATTGGCCCAGGAAAAAATGGGGCCTATTTGATTGGCAGTGTAATTCACCGTGAGATTTGATAATTTAACACTCTTTTCAATGGGTTTCG
ATAAATTGACATCCTAGCCCACTTTCATTCACTCATATGGTCCCACATGTCATCCTCACAAATGTCAATTAAAGTAATTGGGCAACGAAAAAAGTGTGAAATTATCAAATTTTTTTTACA
TTCATCATAGGGGATTAATTGGCTTGGGCCAGGCCAAAAGAAAAAAAAAGTGGTCTATTCGATTGGTAGTCTAGATTAGATGTTAAGTCCATATCCACGGCTGTTTAATGTAGAAGCTGT
ATGGTTGATCGTGCTTCCAATTGATATCTTCGTTGGTCGTGTCCTTCACTCCTTCTGTATATGCAGGTCAGGTCAAGCTGTCTGAGTATATTGGGGAAAAAATATGTGGTTCTGTTCTTC
TACCCCCTGGACTTCACGTTCGTCTGTCCAACAGAT
GCGTTGACCTTGTCGTGCTCTGTCATGGAAATGCCTTTTTTTTCAGTTTTTTTTCATTCCTAAAGTCTAAATGCATGTTTGTAA
GCTCTGCAGAGATCACTGCTTTCAGCGACAGATATGAGGAGTTTGAGAAGATAAATACTGAAGTTCTCGGTGTTTCGATTGACAGTGTGGTATGCTAACTTTTACCCGCATGACTTTAGA
TGTTGTTACGGTGTCGTTACCTGGTCTGTTGCTCTATTGAGAATTTCGTATTTCCATTCCATCTGGACATGTAGCTTTTCTCTTGACAATATTTGTGGTTTCTTGAATGCCTTAAGGTTG
TGATCAATATTTTAGCTTTCCTCTTTATGTGATCAATATTCTATTTGTTCTTAACGTCTGAATATAGAGCATTAGATGAACCCTTGCATTAGGCCATAAGTTTTAACATAAGATTGCCAC
GTGTTGAACTTTCATTCTGTATTATAATGAAATGTGTGGTGTTTGTTATGCCTTATGGAAATATTGAATGGAAGTAAAAACCGATGCTCTCTAATATTTAGACAATAGCGTTATAAACAT
TCAATTCAGTTATTTTGAAACAACTTTGAGAAATGAGACTGATGTAACGTCTTAATACTCTGGTTTGCTTCTGCCAAGGAGATTCATTGCATACTCAAATAATTATCACAAATTATATCC
AGTAAAAGTATTGATTTTGCTACTATTACAGTGAGTAGTTTGTAGGCAGTAGTGGTACTGTAATTTATTTTTTACTATCCTCTCTTTCTGCTTCTGCATTAAGCATTTCATTTTTTTTAT
CTTATAGGTATCATTCACTGTTACTCTGTCGACTATAAATATTTAATAAGTGGCCACAACCTATGCTTCATAAGTGTCGCATACTAATTTGGCTTTGAAATATCTTTTGTTTGCAGTTTT
CCCATCTTGCATGGATTCAGACAGATAGGAAATCCGGTGGTCTTGGTGATCTAAATACCAACTGATTTCCGATGTCACCAAATCAACTAGCATAGTGGCCCGCGCAGATTGCGCGGCTAG
CATCATTATATTTTTTTCTCTTATAATAGCATATATGTTTTCTCAATGTATTATTAAAATATATTAAAATAACAACATAATTTTGTGTGTGTTCATGAGAGCGAACTTCCAATATTCCTT
TGAATTTTAGTTATTTGTAAATTGTATTTCTATATGTACTCTAAATTCTACTTTAATTTTATTAGTTTTATTCTGAATTTTAAATTCTTATATGGATTCTATACTCTTCTTCTAATATTC
CTTATTTTAATTCCTAATTTATATTATTTGTAAATTTTATTTCTATATATGGATTCTAAACTTATCTTTCAATATTTTTTAATTCTTAATTTTAATTATTTTTAAATTATATTTCTATAT
GGACTCTATATTCTTCATCCAATATATTTTTTTAATTTCGAATTTTTTATTTCTAAATTGTATTTCTAGATGGACTCTAACCTCTATATTTAATTTTTCTTATTTTTTAATTCCGAATTT
TCATTAGTTCTATTGCCCCTAATTTCTATTATTTCTAAATTGTATTTCTATATATGGATTCTAAACTTATCTTTCAATATTTTTTAATTCTGAATTTTAATTATTTTTAAATTATATTTC
TATATGGACTCTATATTCTTCATCCAATATATATTTTTTTATTTCGAATTTTTTTATTTCTAAATTGTATTTCTAGATGGACTCTAACCTCTATATTTAATTTTTCTTATTTTTTAATTC
CGAATTTCCATTAGTTCTATTGTATACCGACATGGACTCTAGTCTTACCTTCCTATATTCCTTATTTTTAATTCCGAATTTCAGCTATTATTAAAATTGTATTTCTATATGGACTCTGTT
TTTTCTTTTTCTTAGATTAATGTGAGAATTTCTAGACCATGAGAGCGAACGTGGAGGCTTCTTTTTCTATTCCTTTAATAATATAATAGATTTCAAAGTCTTTTGGTGTACTAATCCCTG
ATCAGGTATACTTCAGTTATGACTGCCTGTTGGCTATATATACAATATATGTCTTTCTTCTGGATATTTACTTGTTTGTATTCAAAGTCTTTTGTCATGTATTCCTTGTTCTTAATCTCA
TAAGAGCTCATACTTTCTGCTGTCAGGGGATTGCTCTGAGAGGATTATTCATCATTGACAAGGAGGGTGTGATTCAGCATTCTACCATTAACAACCTTGCTATTGGCCGTAGCGTGGATG
AGACGCTTAGGACCCTTCAG
GTAGAATAGCAAGATAATAAAATTGCATCTGCAAACATGCATTTCTTTTCAATATACATGGCATCTTGGCAGTTTTTTCGTCTTGAATTTACCATAGTCT
AGTGTCTATAACATCAAAAATTGCTCAACTAGTTATAACTGTGAGTGACAAAGTCAGATAGGAAAATTTTTTGCAAATATGCAAGTTCGTAATTTGTTTTCCTATGGTGACAGGCCCTAC
AGTATGTCCAAGAAAACCCGGATGAGGTTTGCCCAGCTGGATGGAAACCTGGGGAGAAGTCAATGAAGCCTGACCCCAAGGACAGCAAGGAGTACTTTGCTTCTATT

Retrieve as FASTA