Entry information : OlAPx-R
Entry ID 7453
Creation 2010-08-05 (Christophe Dunand)
Last sequence changes 2011-06-14 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2017-03-16 (Marcel Zamocky)
Peroxidase information: OlAPx-R
Name OlAPx-R
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Prasinophyceae Ostreococcus
Organism Ostreococcus lucimarinus    [TaxId: 242159 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OlAPx-R
start..stop
S start..stop
OtAPx-R 424 1e-150 73..318 66..311
BprAPx-R01 327 2e-111 73..315 120..366
MpuAPx-R 303 2e-102 73..317 105..346
EUgAPx-R01 278 4e-94 77..318 1..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29634..29839 206 N° 2 29959..30709 751  
join(29634..29839,29959..30709)


exon

Literature and cross-references OlAPx-R
DNA ref. GenBank:   NC_009362.1 (29634..30709)
Protein sequence: OlAPx-R
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318
PWM (Da):   %s   34328.13  
PI (pH):   %s   6.27
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTARAIIAPAIVRSPVPSSSSRDRRRHRAAPSTTTARAVSRRELGLTLLGTTLGTLVGESNARDARAMSDGDDEPSVRRAIRAALEANVQKTKCPAVLRLVFHDAGTYLASAKDGGMNASVRYELNRPESFGLKRGLNVVKSAYDALDDTAAAGKVSFADMIACAGAYAVEFTGGPAFLERVPLGRIDVETADPENRMPEQTLGGKEMREHFARSGITTRDMVALAGAHTIGGKGFGDAYTFDNAYYATLAADPWHKANMTKDEAEMAEHIGLPSDKYMREDAESMEWIRKYANDQDAFFVDFVDAYIRLAALGAEFA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCGCGCGCGCGATCATCGCTCCGGCGATCGTTCGCTCGCCCGTACCGTCGTCGTCTTCGCGCGATCGTCGACGCCATCGCGCGGCGCCGTCGACGACGACCGCGCGCGCGGTGTCC
CGACGCGAGCTGGGGCTGACGCTGCTCGGGACGACTTTGGGGACGCTCGTGGGGGAGTCAAACGCGCGAGACGCGCGGGCGATGAG
GTGCGCGCATCGCTCGCCGACGGTGACGCGCGAA
CGAGCGATTCGCGGCGTCGAAAGCTCGGAAGTTTCGCACGCGGACTGACTGACGCGCGCGCCGGTTTCGGTTTCCGCAAACGCAGCGACGGCGACGACGAGCCCAGCGTACGAAGGGCGA
TTCGCGCCGCGCTGGAAGCGAACGTGCAGAAAACGAAATGTCCAGCGGTGTTGCGCCTGGTGTTTCACGACGCGGGGACGTACTTGGCGAGCGCGAAGGATGGAGGGATGAACGCGAGCG
TGCGGTACGAGCTCAACCGACCGGAATCGTTTGGTTTGAAGCGAGGATTGAACGTGGTGAAGAGCGCGTATGACGCCTTGGATGACACCGCGGCCGCCGGCAAAGTATCGTTCGCGGACA
TGATCGCGTGCGCGGGGGCGTACGCGGTGGAGTTCACGGGTGGACCGGCTTTCCTGGAGCGCGTTCCGCTCGGTAGAATCGACGTCGAGACGGCGGATCCGGAAAATAGAATGCCGGAAC
AAACTTTGGGCGGGAAAGAGATGCGCGAACATTTCGCACGAAGTGGGATCACGACCAGAGATATGGTTGCCCTCGCGGGGGCGCACACGATCGGAGGAAAAGGTTTCGGCGACGCGTACA
CATTCGACAACGCGTACTACGCCACCCTCGCCGCCGACCCTTGGCACAAGGCGAACATGACCAAGGACGAGGCCGAGATGGCTGAACACATCGGTTTACCGAGCGATAAGTACATGCGAG
AAGACGCCGAAAGTATGGAGTGGATTCGGAAATATGCCAACGATCAGGACGCTTTCTTCGTCGATTTCGTTGACGCGTACATTCGACTCGCCGCACTCGGTGCCGAGTTCGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCGCGCGCGCGATCATCGCTCCGGCGATCGTTCGCTCGCCCGTACCGTCGTCGTCTTCGCGCGATCGTCGACGCCATCGCGCGGCGCCGTCGACGACGACCGCGCGCGCGGTGTCC
CGACGCGAGCTGGGGCTGACGCTGCTCGGGACGACTTTGGGGACGCTCGTGGGGGAGTCAAACGCGCGAGACGCGCGGGCGATGAG
CGACGGCGACGACGAGCCCAGCGTACGAAGGGCG
ATTCGCGCCGCGCTGGAAGCGAACGTGCAGAAAACGAAATGTCCAGCGGTGTTGCGCCTGGTGTTTCACGACGCGGGGACGTACTTGGCGAGCGCGAAGGATGGAGGGATGAACGCGAGC
GTGCGGTACGAGCTCAACCGACCGGAATCGTTTGGTTTGAAGCGAGGATTGAACGTGGTGAAGAGCGCGTATGACGCCTTGGATGACACCGCGGCCGCCGGCAAAGTATCGTTCGCGGAC
ATGATCGCGTGCGCGGGGGCGTACGCGGTGGAGTTCACGGGTGGACCGGCTTTCCTGGAGCGCGTTCCGCTCGGTAGAATCGACGTCGAGACGGCGGATCCGGAAAATAGAATGCCGGAA
CAAACTTTGGGCGGGAAAGAGATGCGCGAACATTTCGCACGAAGTGGGATCACGACCAGAGATATGGTTGCCCTCGCGGGGGCGCACACGATCGGAGGAAAAGGTTTCGGCGACGCGTAC
ACATTCGACAACGCGTACTACGCCACCCTCGCCGCCGACCCTTGGCACAAGGCGAACATGACCAAGGACGAGGCCGAGATGGCTGAACACATCGGTTTACCGAGCGATAAGTACATGCGA
GAAGACGCCGAAAGTATGGAGTGGATTCGGAAATATGCCAACGATCAGGACGCTTTCTTCGTCGATTTCGTTGACGCGTACATTCGACTCGCCGCACTCGGTGCCGAGTTCGCGTAG

Retrieve as FASTA