Entry information : GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Entry ID 7454
Creation 2010-08-05 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2015-03-23 (Christophe Dunand)
Peroxidase information: GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Name (synonym) GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Class Ascorbate peroxidase related     [Orthogroup: APx-R001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx-R[P]-R
start..stop
S start..stop
GmAPx-R 383 4e-136 1..220 82..314
LjAPx-R 342 9e-120 1..220 80..312
MtAPx-R 340 6e-119 2..220 84..315
VvAPx-R 317 1e-109 3..220 95..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5505338..5505481 144 N° 2 5505774..5505831 58 N° 3 5505898..5505997 100 N° 4 5506303..5506386 84
N° 5 5506680..5506801 122 N° 6 5507270..5507336 67 N° 7 5508095..5508206 112  
join(5505338..5505481,5505774..5505831,5505898..5505997,5506303..5506386,5506680 ..5506801,5507270..5507336,5508095..5508206)


exon

Literature and cross-references GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
DNA ref. Phytozome 12:   Gm04 (5505338..5508206)
Protein sequence: GmAPx-R[P]-R (Glyma04g07090 / GmAPx[P]-R)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   229
PWM (Da):   %s   24741.86  
PI (pH):   %s   5.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RPGTKEYLLIKEEVRKVLSKGKAAGVLRLVFLDAGTFDIDDSTGIILLVLQQAKTQIDVIQPNILLSVSWADMNIAVAGAEAVEVCGGPPIQVSPGRLDTLVHDPEGRLPEESLNASGLKKCFQSKGFLTQELVALSGAHTIGSKGFGSSISFENSYYKVLLEKPWTSGGMSSMIGLPSDHALVEDDECLRWIKKYADSENLFFEDFKNAYVKLVNSGVGGIAYKFR

Retrieve as FASTA  
Remarks Pseudogene from genomic (chromo 4). 2 first exons, fragments (xxx) and stop codon are missing. ORF predicted by Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGCCAGGTACAAAGGAATATCTTCTCATTAAAGAAGAGGTGAGGAAGGTCTTGTCAAAGGGAAAGGCTGCTGGCGTGCTTCGATTGGTTTTCCTCGATGCCGGAACCTTTGACATCGAT
GACAGTACAGGTATAATACTTTTA
TCTCATCTGAGGGACTCCAAGTTTCTGTTTTTTTTCAATTTTCACAGTCCTTCTGCCTTTCTAGCAAAAGCCAATGGAATTTGGCTCTCTTGTAAA
ATGAAAGTAAATCAATTGTTTGAAATGGTTTGACATCATCACGGTTGAAAATCAGTAAAGGCATGCTCTGTCTCACTATTTTCTCGTTTCCCTTCTGTCACCTCTCTTTCTAGTACTATT
TGAAGATCATTAAGACAAATATCTTACATTTTAACTGCCAGCTAATATCTCAGTGGACGTATCACATATTTTTTAGGTTCTGCAACAAGCAAAGACTCAGATAGATGTTATCCAACCAAA
TATTCTTCTATCTG
GTAACTGCTGCTAATGGTAAGCGATAATTTGGTCCAGACCAACAAATTTTTGCTTATCTTTATTAGTATCTTGGGCGGACATGAATATTGCTGTGGCTGGAGCTGA
AGCAGTTGAAGTATGTGGAGGTCCACCTATCCAAGTTTCACCGGGTAGATTAGATACATT
GTAAGATGCTTGGTTTCTGGTTGACATGTTCTCGAGTTAGTACGTATGACGTGACAAGAA
ACTGGTTTTTCTTAACAGGATGACAAACAAGCAGTTATATGTTAGTTTTGGTGCATTAGGTTCTGTGAAAATGTTTTTTAACCAATTACTGAATTTTGTCCAATCTGTTGTTTAATGAAT
GATCAACCATTTTGCAGAGAAAAAAAAAAATCCTCCATGGGAACTTAACTCATTGGTTTTCGCATAACACATGAAATCTGGTTTTGTCTTCAGTCAGATGCTATTTGCATTCATTTTAAT
GATAGGGTGCATGATCCAGAAGGGAGACTTCCTGAGGAATCTCTCAATGCTTCTGGTTTGAAGAAATGTTTCCAGAGCAAAGGCTTTTTGTGAGTATGAGAACAACACCTATTTTATAGT
TTAGACTAGTGCAGCTATACATCATCTAGAAGCTGTCTGATTGTCCATAACTTAACATGAGAATCTTAACATTACAGAAGCAAGAAATATTGTGATAAAGTCCCGATTCTAAACCAGACT
AACAAGGCAAGAAATATTGTGATTTACTGACCAAAAAATCACTGGTAATAAGCTTATTAGTTATTGTTTAAAATTTTCAACGTATTTTACTTGAATTAGTTTTGCTTATGCATCCTTATC
ATTTGGAGCTTTTCTTTTATAGAACACAAGAACTTGTGGCTTTGTCTGGAGCCCACACTATTGGAAGTAAAGGTTTTGGAAGCTCAATTTCTTTTGAAAATTCATATTATAAGGTTCTTT
TGGAGAAGCCCTGGACGTCTTCAG
GTAAGTTAACAGCTTATTTCATCTAAACATCGTTTTTATATTTTTTGTAAACTTGCTGCCAATCATTGTTTTCTGAAGCAGTTCTCTTAGAACAAA
AACAACAAGGAAATGAATACCAAAAAAAAAAAAAAAGGAAATGCAGGAGTTGAATGCATGTCACTATGTTAAGCTTAGCCACTAGATTATCACATAATTTATGTCCAGTCTGCTCTGGAT
CTTAATGTTCCAATCAAGTTTTTCAGTTTCTTTGCCATCAGTTGTGCCTTCCAATAAACTACTATAAATGACATTAATATCTGGTATAGCGGCTCAAGTGGGTTAATGCATAGGCTTAGG
GCCAAATCAACAACTCTACTCTGGTTGCATGCTCATTTTTCTGGATAGACCCAACATAATTATTGGTTTGTTTTTGTCTTTCTTTTTTTAATAATTTGTATAATTCTCATCTGCCGGTTC
TCTTTTATGCAGGTGGTATGTCGAGTATGATTGGCCTTCCTTCAGATCACGCTCTTGTTGAGGATGATGAATGCTTAAGGTTCTTTATCTCTTTCTCTTATGCTACTCTTGATATGAAAT
TGGCCCCCACTTTTTTTATTTATTGGCTAAGCTAGCACTAAAATTTTAGTACAAAAGTGGTAAATCCTTTAAATAATTTGAAGTTATCTGAACAGATAAAACAATTAAAATACGAAGCAT
ATCGTTTTCTTATTTTTCAGAATTCTATAAAATAACAGGTAACGCAAATAATCCATCAATTGGAAACAAGTAACAACTGCATATCGATTGGTAATGAATAAGTTATGTTCGTTAGATTTG
TCTGACACTATCATTTGTGATTCAACGTGTCTTGCCATAGTAAACCATGTCCTTGTTTCTGGAGTACTAGCTTACACTTTACACACAATAGTGAAACATCAATTTTTAAACATTTAGGTC
ATGATCCTGAGCCTAACGCGTGCTCCTGTTCAAATGCTTGTATTATAGTTGTTTGTTGGTCTGAGGACTCATTTTGATTCTTTTTGTCCATGTAAGCAAACAATGACGTGCTGAAAAGAA
TATTGTCTTTTTAAGTAAACTTGAGTCAGTATTGTCTATCAAAAACTCCCATCAATCATGTACTTTAGGAGGGGAAAAATTTAACAAAACTTTTTAGCTGGACCATTGTATTATATCTTA
TTGATGTCTAAAAATTCAATTGCATGTTACATATCCCGGTGCACCGCATGTGCATGTTTCTGCTAATTATATGTTCCTTGGTGTGCATAACTTAAGAGAGTTCCATTGATTGAACAGATG
GATTAAAAAATACGCAGACAGTGAGAATCTGTTCTTTGAAGATTTCAAAAATGCGTATGTCAAGCTGGTGAATTCTGGTGTGGGTGGAATAGCTTATAAATTCAGGAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGCCAGGTACAAAGGAATATCTTCTCATTAAAGAAGAGGTGAGGAAGGTCTTGTCAAAGGGAAAGGCTGCTGGCGTGCTTCGATTGGTTTTCCTCGATGCCGGAACCTTTGACATCGAT
GACAGTACAGGTATAATACTTTTA
GTTCTGCAACAAGCAAAGACTCAGATAGATGTTATCCAACCAAATATTCTTCTATCTGTATCTTGGGCGGACATGAATATTGCTGTGGCTGGAGCT
GAAGCAGTTGAAGTATGTGGAGGTCCACCTATCCAAGTTTCACCGGGTAGATTAGATACATT
GGTGCATGATCCAGAAGGGAGACTTCCTGAGGAATCTCTCAATGCTTCTGGTTTGAAG
AAATGTTTCCAGAGCAAAGGCTTTTT
AACACAAGAACTTGTGGCTTTGTCTGGAGCCCACACTATTGGAAGTAAAGGTTTTGGAAGCTCAATTTCTTTTGAAAATTCATATTATAAGGTT
CTTTTGGAGAAGCCCTGGACGTCTTCAG
GTGGTATGTCGAGTATGATTGGCCTTCCTTCAGATCACGCTCTTGTTGAGGATGATGAATGCTTAAGATGGATTAAAAAATACGCAGACAGT
GAGAATCTGTTCTTTGAAGATTTCAAAAATGCGTATGTCAAGCTGGTGAATTCTGGTGTGGGTGGAATAGCTTATAAATTCAGGAGT

Retrieve as FASTA