Entry information : MeAPx-R (cassava4.1_018316m)
Entry ID 7460
Creation 2010-08-09 (Christophe Dunand)
Last sequence changes 2015-12-16 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: MeAPx-R (cassava4.1_018316m)
Name (synonym) MeAPx-R (cassava4.1_018316m)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx-R
start..stop
S start..stop
RcAPx-R 499 6e-180 24..335 18..328
PtAPx-R 486 1e-174 1..335 1..337
VvAPx-R 452 3e-161 25..335 22..330
CsAPx-R 429 3e-152 16..335 18..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1403454..1403634 181 N° 2 1403175..1403289 115 N° 3 1402651..1402775 125 N° 4 1402051..1402121 71
N° 5 1397483..1397580 98 N° 6 1397160..1397243 84 N° 7 1396681..1396802 122 N° 8 1396285..1396351 67
N° 9 1395990..1396089 100  
complement(join(1395990..1396089,1396285..1396351,1396681..1396802,1397160..1397 243,1397483..1397580,1402051..1402121,1402651..1402775,1403175..1403289,1403454. .1403634))


exon

Literature and cross-references MeAPx-R (cassava4.1_018316m)
DNA ref. Phytozome 12:   scaffold00847 (1403634..1395990)
EST ref. GenBank:   DV446698.1 [3' end]
Cluster/Prediction ref. UniGene:   Mes.8692 [3' end]
Protein sequence: MeAPx-R (cassava4.1_018316m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336
PWM (Da):   %s   36788.96  
PI (pH):   %s   7.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLTILPAKAPLVSSIPSSSSHLEFKFPVKLQHSSLSTVKFRLKPLQARFIPATGDEDSGENLDWVSKRRRNLICVSTLPFLFHFRESFEGFSAEAAELDATYMLMKEEVRKVVSKGKAPGVLRLVFHDAGTFETDGNSGGMNGSIVFELDRPENAGLKKSLKILQKAKSEVDSKQSVSWADMIAVAGAEAVSICGGPTIPVILGRRDSVEPDAEGRLPEESLGASALKQCFKRKGLSTQVLVALSGAHTLGSKGFGNPFVFDNSYYKILLEKPWNSSDKMASMIGLPSDHALVEDDECLRWIKKYADDQDIFFEDFKNAYIKLVNSGARWKSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTTAACCATTCTCCCCGCCAAAGCTCCTCTTGTTAGCTCCATTCCATCCTCCTCTTCCCATCTCGAATTCAAATTTCCCGTCAAATTACAACATTCCTCTCTCTCAACTGTC
AAATTTAGACTCAAACCTCTCCAGGCTCGCTTTATTC
CGGCCACTGGCGATGAAGATTCTGGTAAACTGTACCGTCTCTTTATCATGGTGTGTTTGATTGCTGAGAAAACGAAGCAAATA
ATAATAATAATAATAAAGAGAAGAAGATAAGAGTAGTTTTTCTAATATGTTAATAAAGAGAAGAAGATAAGAATAGTTTTTCTAATATGTTTTTGGGGTCTACAGGCGAGAATCTTGACT
GGGTTTCTAAGAGGAGGAGAAACCTCATTTGTGTTTCCACACTGCCTTTTCTATTTCATTTTCGAGAATCCTTCGA
GGGCTTTAGTGCTGAGGCAGCTGAGTGAGTTAATCAAATCCCTC
GCTTTTTTTCTTTGGTTCAGCTGCTTCAATTTTGAATCCCTTTTCTTTTACTTGTAAACGTTTGATTCAAGTAGACAATACACGACTATGATTTTGTTCCGCAACTATAGGAGGATTGTT
GACATATACTTCTACTGTCTTCATGTTTCCTTTTTTTCTAGTGGAGGTTTATCTTGAAAGATGATCCTCGAATTTTTTATGTCACAGACATGTGAGTGCTCAGCTACTTACAGCCTCAAT
GTTTGTGACTTAGATGCTTTAGTGTAATCTTAAGTGTGTCCACGGTAGATATATGTGTTTCTGCTTGTAGTGCCTCACTAGATGCTAGTTATTCAATGTTCTTATTTTTATGATTTTCTT
TTCTCTGTTGATCCTGAAGATTGGATGCCACATATATGCTCATGAAGGAAGAAGTAAGGAAGGTAGTGTCCAAAGGCAAGGCTCCTGGCGTACTTCGACTTGTTTTTCATGATGCAGGAA
CCTTTGAAACGGATGGTAATTCAGGTATTTATCATGGGAAAATCATATGATTTTAAAGTGATTATAGTTATCATTTGTATTAGGAATTCCCATCAAATGGTTTGATAAGATGTTTTATTG
GACCTTTGTAATATAATGAAAACTTTTAAGTAAAACTTTATGTAACTAGGTTGTTATGATGTGAACTTTTATTGTCTGGGGTATGCACACTTAAAATTAATTCATGGAGGATTACTGCCA
AAGCTACTTCCTGCTAAGACAATTTATGCCAATCAATAAGCTCATTCATTAGTAATTCTGTAGAATCATTTGAATAGCTTGAGATGGTTGATGCCTTTGGTGTTCAAGGTGCTGTGGAAA
TTATTATTTTAACTTTGGTTCTGTTGAAATGGTATGTGAACACGGGTGAAGCCATTCAGTTACTGTGAATTATTTTTTTATGCTGCAGTTTGTTCTTTTTCTTGTTTGCTTATTCCTTTA
CATTCAAACTTACTAGGTATAGTGCTGTTCTCTTTTGCTTTAGACTTACTCTACACTATGATTATATCTGCAGGGGGTATGAATGGTTCTATAGTTTTTGAACTTGATAGACCTGAAAAT
GCAGGTTTAAAGAAATCTTTGAAGGTATTTCTCTCTCGCTTTCTCTTCTATAAACACCAACATGTAACCTGCTCGCTTGTATATGAATGCATATTTGAAGTTTGAGTGTGTGGTTTTAGC
AGTTTTAATAAATATGTTTACTCTAAATTATAAAATTAATATAAATTTGTAGTGGTGAATCATAATATATACTACTTATGTCAAATAACATACTTTTAGTGACCAAGTAGTTTCACTCAA
ACTTTTTGTAATTAAAAAAAATCAAGTTAAAGAAAAATTAACTCAGAGTAGTCTTTTCAGAATTTGACAATAACCATTTATGGTGGTTGTGAGCTGTAGAAGGATAATATTTATTGTATA
TCACAATAGAGATTACAACCTATTTATACATGAGAGACAGTAACTAAACAGAAAGGAAATGACAATCAATCTCGATGTGTTTAGTCCTCTCGTGAAATACTGGATTGGAGGCAATGTGGA
TAGCTGCTTGATTATCACATTACAACTTAGCAGGCACCGAATTTGTGAACCCAACTTCTTCCAACAGTTGACGTACCCACAAGATTTCACAAACGGCTTGTGCCATAGCTCGATATTCAG
ATTCAGCACTAGAACGGGAGACCACATTTTGCTTCTTACTTTTCCATGAGACCAAGTTACCTCCCACAAAAACACAATACCCAGTAATTGACCTCCTATCAACTTTCGAGCCTGCCCAAT
CAGCATCACAAAAGCATTCAATATTTGAGTGCCCATGGTTACCATAGAATAGGCCTCTCCCTGGGGCCCCTTTAAGGTAACAAAGAATCTGTCCTAGAGCATCCCAATGGGCAACAGTAG
GAGAAGACATAAACTGACTTACCACACTCACTGAATATGCAATATCAGGACGAGTCACCGTCAAATAATTCAGCTTGCCAACTAATCTTCTATACCTTCCAGGATCTGCAAATGGCTCAC
TGTCTTCTGTGGTAAGTTGAAGGTTAGGGGTCATTGGGGCACTACAAGGCTTAGCACCCAATTTTCCTGTTTCTGCCAACAAATCAAGAACATATTTTCTTTGAGACAAGAAGATGCCTT
TCTTACACCGCATAACTTCGATTCCCAAGAAATATTTCAAGGAACCCAAATCCTTTGTATGAAACTGTGTTTTAAGAAATTCTTTTAAGGATGTGATGCCAGCAATGTCACTTCCTGTGA
TAACGATATCATCCACATATACTACAAGCAGAATTACTCCACTATCAGAATTTCTATAAAACACTGAGTGATCACACTTACTCATCTTCATTCCAAACTGTTGGACCACCTCACTAAACC
TGCCAAACCATGCCTGAGGACTCTGTTTCAAGCCATAAAGCGATTTTCGAAGTCTACAAACTTTACCTGACTCCCCCTGAGCAACAAAACCAGGTGGTTGCTCAATATAAACCTCCTCCT
GAAGATCACCATGAAGAAAAGCATTTTTAATATCCAGTTGATGCAAAGGCCAATCATGAGTAGCCGCCAAGGAAATAAACAATCGGACAGATGCGAGCTTGGCAACTGGGAGAATGTATC
AGAATAGTCAATTCCATAAGTTTGTGCATAACCTTTGGCCACTAAACGGGCCTTGAGGCGAGCAATAGATCCATCAGGATTTACTTTCACTGCAAACACCCATTTGCACCCAATAGCCCA
CTTTCCTGGGGGCAAGGACATCAACTCCCAAGTACCATTAGTGTCGAGGGCCATCATTTCCTCTTCCATTGCAGCACGCCAACCAGGATGGGACAAAGCCTCAATAACAGTTTTGGGAAT
TAAAATAGAATCTAAAGCAGTGATAAAACAACGAGAAGAGGAGGATAATTGATCATAAGAGACACAAGATGAAATAAGATAAGTGCAAGTACGTTTACCTTTGCGAAGAGCAATGGGCAA
ATCCAAATCAGACAATGAAGGATCAGTAGGAGTAGGATCGGTCGACGAAGAAGCGAGTAGCGGAACGGAGTCAGAGTCCTCTAAGCGTCTGGAATACACATGAAAGATGGGAGGGCGACC
TGGCACATGAGCGAAATGTGTAGGAGTAGTCTGAGGAGAAGAAGAGCGAACAGTGTATAACAAGAGGTCATCTTCCTCCTCCTGGGTGTTATAAACAGATGATGGCGGAAAAAACGGAGT
GGACTCAAAGAATGTTACATCCGCAGACACAAGATACCGATTCAGATCAGGAGAAAAACAACGATACCCTTTCTGACGTCGAGAGTAGCCAAGGAAGACACATTTGAGTGATTTGGGATC
CAATTTAGTAACTTGTGGACGAACATCACGAACAAAACAAGTACAACCAAAGAGACGTGGCTCAATAGGAAATAAAGATTTAGTGGAAAATAAAATGTTATAAGGGATATCACCATGAAG
GACGGAGGAAGGCATGCGATTGATCAAAAAACAAGCAGTGGATACAACATCAGCCCAAAAACATTTAGGTACCTTCATTTGAAATAAGAGGGCTCTGGCTACTTCAAGAAGATGTCGATT
TTTTCTTTCAGCAACTCCATTTTGTGAAGGAGTGGCAACACAAGAGGACTGATGAAGAATCCCTTTTTGTAACAAATAAGATTGAAATTCCCCAGAGAGATACTCTTTAGCATTATCACA
CTGCAATATACGGATGGAAGTATTGAATTGGGTTTGGATTTCAGCATAAAATGCACAAAAAATAGAAAATAATTTTGAATGACTCTTCATTAAAAATAACCAAGTAGTACGAGAGAAATC
ATCAACAAAGGTAACAAAATGCTTAAAGCCAGACTTAGACACAACAGGACAAGGACCCCAAACATCTGAATGGACTAACTCAAAGGGAGACGAAGCCCGTTTATTGACTCGAGACAAAGT
AGGTAAACGATGATGTTTGGCAAATTGACAAGACTCACAATCTAGAATAGACAAAGAATGAAACTGTGGATATAACTTCTTCAAAACCGAGAGAGAAGGATGCCCTAAACGACAATGAAC
ATCAAAAGGTGTTAAACGCGTGGAGCATACCAGAGATCGAGGAGATCGAGGTAGTTGCTGATCCAAGACGTAAAGACCCTCTGACTCACTTCCTCTACCAATAATCTGCTTCGTCGAAAG
ATCCTGAAAAACACAGTGATCAGAAAAGAATGAGACACAATAATTCAATGCATGAGTGAGTTTACTCACGGAAAGCAAATTAAATGCGAACTTAGGGAGACATAACACAGAGGATACAGA
AAGAGAAGGGGTTAAGTTGACATGACCAGAACCCATGACAGACGATTTAGTGCCATCAGCAAGAGTAACATAAGAAGGCAATGTATGAGACTCAAGATTGGACAAAAGGGTAGAATTACC
TGACATATGATCGGTAGCACCAGAATCAATAACCCATTTGGAGGATGAAGACACAAGACATGCAGTAGAGTTACCTGACTCGGCAATTGCAGTGATAGAAGAGGAATTAGAAGATTTTAT
AGATGCCTGGTATTGGATGAATTGTGCATACTCATATGCAGATATCAAAATTCCCTGATCGGAAGATCCATTCAATTTGTGTTCCGTGATTTTAGTCATCATAGGAATCACATCAGTTAC
GGTGGTGGTTTTAACTTCAGCCATAAGGACAACAAACCCAAAAACGATAGCAACAAAAGAAACACAGAATCAGAAAACAGTACCCGGCGTGAACGGTACCGATGAACAGTACCGGTGAAC
AGTACCCGTGAACAGTGCCGATGAACAGTACTAAATAAAACACCTCCACCCAACACCCGAACGTTAAACAAACCTCAAATCTGACAAGGAGTCGGTGTGGTGACTCCAGCGATGGTTAGA
TCCAAATGTTACCCTTTATGGATAACCCAAATGAACGGAGCCCTAAGTCTCCAAAAAAAATTTTAAAACTTTACGAGAGAGAAAAGAGAAAAAAAATCTCTATGAGAAAGGCTCTGATAC
TATGTAGAAGGATAATATTTATTGTATATCACAATAGAGATTACAACCTATTTATACATGAGAGACGGTATCAAAATCAAGCCTATGATTATACAATCCCTAAAATTAAGCAACTGACCC
ATCTATCAATATTTACTTCCTATATTAACATATTTACTTTCTATAACTTATAACATGAGCAATACCACCTCTATGACTAGTGGCATTGGCCATCACCTTGTTCACGTGGCTAAAAAATCC
TGATTTGGAAAATTTTTCAATTTCACAGATTTCCATATGTATATATATATACTCTTTGAACTCAGTTTTGGTGAAATGCTCTCAAATTGTGCATGATCTCCTGCCAGCTAACACGAAACT
GGGTGCATTGTTGTTTAGATTCTTCAGAAAGCAAAGAGCGAAGTGGATTCAAAACAATCAGGTGGTTATTATGGTGCTGTATGAAAGGGGTCAATAATGGTAGATGTATGTTTCCTTGCT
GATGCAACAATTTCTTTTCCGTTGTTAGTATCGTGGGCAGACATGATTGCTGTAGCTGGAGCTGAAGCCGTTTCAATCTGTGGAGGTCCAACAATTCCAGTTATATTAGGAAGACGAGAT
TCAGTGTA
AGACAGTTTAAAATGGAATAAGACTTGGTATTAGATATATGAACTGAGTTACTAAGGTTGAGTTATCCACAAGCCTTTCAAATGAGCTTGTGAAAAACTTGCCAAATATTGT
TAAGCTTGATTGAAAATCATGTCTTGATTTATGCAGCTTTAGTGTAAAATTATGAGGAAAGTAGGAATTTTCAACAGTACCTCCTTAAATTCTCGGCTTTAATAGCTGCAATATCTCTTT
ACAGGGAGCCTGATGCTGAAGGCAGACTTCCTGAAGAGTCTCTGGGTGCTTCCGCTTTGAAGCAATGTTTTAAAAGAAAAGGCTTATCGTGAGTTTACGTCCGTGTTTTCATTGGCATTT
TGCATATGTAATTGTAAAAAACTGTTTAAACATGTCAATTCTCCATTTGCTATGTGAATTTGAGCTTTTAAAACCAATTTCTTTGGCCTTCAAAATTGACTTTGTTGTTTCAACATTCTC
ATTTGGTATTACTGATTGCATGTGAGATTACCTTAAAAAGTCTTTCATTGCCCTATACTTGGTTTTGTTGCAATTACCAAAGAAAATATAAAATTTAACAATCTTTCGATTTTTTGTCAT
GATTATGTTAAGATATGGAGTGCAATGATATATTATGGACTGTACACTGTTCCACAGTCTGATGGAAACCATTCCTGCATCACAGAACACAAGTACTAGTTGCCCTGTCTGGAGCTCATA
CTCTTGGGAGTAAAGGCTTTGGAAATCCATTTGTTTTTGACAATTCATACTATAAAATTCTCTTGGAAAAGCCATGGAACTCTTCAGGTA
AAGATTATTCAACAACTTGTTCTGGCTGTA
TTAGTATTAGATAGTTCTTTTTATAATCTCAAATTGTTCATCTTTAAGGTATCTGAGAACCCTGTTACACTGCTGGCATAGTATGCATCACAACAAATGACCATTTGTCCACAGCCATGG
AAGAAGACTTCTCCTGCCATTTCATTTCACTAGTCAAAACTCCCAAGTTCTTTACATTAGTCCTTTTGACTAAACCAAGCATTTATTTAAAGTATTTACCACATTTTTGGTCCCTTTTCT
TTGAAATTTTTTCGGCATGATCTGATATCACTATTGCTTCTGTTCTTTAATTGCAGATAAAATGGCAAGCATGATTGGACTTCCTTCAGATCATGCACTTGTTGAGGACGATGAATGCTT
AAGGTT
GGTCATCTTCTGAAACCTCCCATTTCTGTGTTAAACACTCATGAACTGCACCATAATGAATCAGTCAAGCAAATGTGAAATTGTTAGACTTAGTTTTTGCTTCCTCTATATGCT
TGTCTGAAAAAGAAACTCATGACATTATAGCATAAACATGGGCTCACAACACTGAAAGAAAACTCATGTTTGGTTCAGATGGATCAAAAAGTATGCTGATGACCAGGATATTTTCTTCGA
AGATTTCAAGAATGCGTATATCAAACTTGTGAATTCTGGTGCAAGATGGAAAAGCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTTTAACCATTCTCCCCGCCAAAGCTCCTCTTGTTAGCTCCATTCCATCCTCCTCTTCCCATCTCGAATTCAAATTTCCCGTCAAATTACAACATTCCTCTCTCTCAACTGTC
AAATTTAGACTCAAACCTCTCCAGGCTCGCTTTATTC
CTAATATGTTTTTGGGGTCTACAGGCGAGAATCTTGACTGGGTTTCTAAGAGGAGGAGAAACCTCATTTGTGTTTCCACACTG
CCTTTTCTATTTCATTTTCGAGAATCCTTCGA
TTCTTTTCTCTGTTGATCCTGAAGATTGGATGCCACATATATGCTCATGAAGGAAGAAGTAAGGAAGGTAGTGTCCAAAGGCAAGGCT
CCTGGCGTACTTCGACTTGTTTTTCATGATGCAGGAA
TCTACACTATGATTATATCTGCAGGGGGTATGAATGGTTCTATAGTTTTTGAACTTGATAGACCTGAAAATTCGTGGGCAGAC
ATGATTGCTGTAGCTGGAGCTGAAGCCGTTTCAATCTGTGGAGGTCCAACAATTCCAGTTATATTAGGAAGACGAGATTCAGTGTA
GCCTGATGCTGAAGGCAGACTTCCTGAAGAGTCT
CTGGGTGCTTCCGCTTTGAAGCAATGTTTTAAAAGAAAAGGCTTATCGTG
ACAAGTACTAGTTGCCCTGTCTGGAGCTCATACTCTTGGGAGTAAAGGCTTTGGAAATCCATTTGTTTTT
GACAATTCATACTATAAAATTCTCTTGGAAAAGCCATGGAACTCTTCAGGTA
AAATGGCAAGCATGATTGGACTTCCTTCAGATCATGCACTTGTTGAGGACGATGAATGCTTAAGGTTG
ATCAAAAAGTATGCTGATGACCAGGATATTTTCTTCGAAGATTTCAAGAATGCGTATATCAAACTTGTGAATTCTGGTGCAAGATGGAAAAGCTTGTGA

Retrieve as FASTA