Entry information : AlyDiOx01
Entry ID 7464
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyDiOx01
Name AlyDiOx01
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyDiOx01
start..stop
S start..stop
AtDiOx01 1217 0 1..639 1..639
ThasDiOx01 1080 0 1..639 1..639
NatDiOx01 1017 0 1..638 5..641
VvDiOx02 1016 0 1..638 1..637
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 249841..249948 108 N° 2 250256..250519 264 N° 3 250932..251081 150 N° 4 251171..251304 134
N° 5 251531..251747 217 N° 6 251838..251983 146 N° 7 252081..252308 228 N° 8 252405..252607 203
N° 9 252685..252928 244 N° 10 253053..253278 226  
join(249841..249948,250256..250519,250932..251081,251171..251304,251531..251747, 251838..251983,252081..252308,252405..252607,252685..252928,253053..253278)


exon

Literature and cross-references AlyDiOx01
DNA ref. Phytozome 12:   scaffold_3 (249841..253278)
Protein sequence: AlyDiOx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   639
PWM (Da):   %s   72948.22  
PI (pH):   %s   6.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAITSLISSVLLKFIHEDFHEIYSRMSLLDRFLLLIVHAVDKMVPWHKLPVFLGLAYLEVRRHLHQEYNLINVGQSPVGTRFDPANYPYRTADGKFNDPFNEGVGSQNSFFGRNCPPVDQITKLLRPDPMVVASKLLGRRKFIDTGKQFNMIAASWIQFMIHDWIDHLEDTRQIELVAPKEVANKCPLSSFSFFKTKEVPTGFFEIKTGSLNIRTPWWDSSVIYGSNSKILDRVRTYKDGKLKISEETGLLLHDEDGLAISGDIRNSWVGVSALQALFIKEHNAVCDALDEDKDLEDEDLYRYARLVTSAVIAKIHTIDWTVQLLKTDTLLAGMRANWYGLLGKKFKDSFGHAGSSILGGVVGMKKPQNHGVPYSLTEDFTSVYRMHSLLPDHLQMRDIDDVPGANKSLPLIKEISMGNLIGRKGEETMSQIGFTKLMVSMGHQASGALELMNYPMWLRDIVPQDPNGQDRPDHVDLAALIYRDRERNVPRYNDFRRAMFMIPITKWEDLTDDEEAIKVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFIIMATRRLEADRFFTSDFNETIYSKKGLEWVNTTESLKDVFDRHYPEMTDKWMNSESAFSVWDSPPVTKNPIPLYLRIPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCAATTACTTCTCTAATCTCTTCTGTTTTGCTTAAATTTATCCACGAAGACTTTCATGAGATTTACTCAAGAATGTCCCTCCTCGATCGTTTTCTACTTCTTGTAAGTAATTGA
ACTTTCATATATATATATATATATGCACGTAGAAACACATCCACGACTTTTTTTTAATTTGGAAATGAATGAATTTAAATTGCTATGGATGGGTTTTCGTTTCTTTAATTCCACAAAACA
CTTTGCTATTAGTCTTAAATTTCAAAAGACTAATATTGGAAATTCGAGATGTTTTTTAATGTAACATATCACATATGTTCACGAGTCCTGGTGACACATTAATTTTGGATGATCTATAAT
GTTTATTTGATATATTGGAAAAATATTTATGATCCGATGTAAATGCATGGTGCAGATCGTGCATGCAGTGGATAAGATGGTTCCATGGCATAAGCTTCCGGTTTTCTTGGGTTTAGCCTA
TCTTGAAGTACGTAGACATCTTCACCAAGAATACAATCTTATCAACGTGGGTCAAAGTCCGGTTGGGACCCGGTTTGATCCTGCTAATTATCCGTACCGGACTGCTGACGGAAAATTCAA
TGATCCGTTTAATGAAGGCGTCGGCAGTCAAAATAGCTTCTTCGGAAGAAATTGTCCCCCCGTCGATCAGATAACAAAG
GTAAATTCACATACATATATGTGTATTAAGGTTTCGAATTT
GATTTGATTTTAATCCAGATATTTGGATTTTAGATTCATTAATTAGATGATCAAAGTATATACTAATTAAACTTTATTAATAAAACGTATATAAACTAAACTGAATAATTTATCAAATCA
TTTTTGATTTGGAGAAAAGAAAATACTTTACATATTTTGTTTCTAGTCTTGTATGAAAAATGAATTGCAAACCAATTAAAATTGGGTAATGAAGGAATTTACGTTATGCTAATATTTTCG
ATTTGATAGCTAATATAAAAGAATAATTTATTGAGAAGTTTGTATATTTAAACACGTTTACCCATTTTTAGCAAGTTTTGAAATATTTTAAAACAAAAGAAATTAAGCCTGTTATAATGA
TTTTTTTGAAGTTACTGAGGCCAGACCCCATGGTGGTGGCGTCAAAACTATTAGGAAGGAGAAAGTTTATTGACACAGGAAAACAATTCAATATGATCGCAGCTTCTTGGATTCAATTCA
TGATCCATGATTGGATTGATCATCTTGAAGATACTCGCCAA
GTAAATTTCAATTCACACACTTATAATTAATATGCTATATAACGAAACAATTAAGTTTGGTTTATTCCGGTTAAATATT
GGTAACTTAGATCGAGCTTGTGGCTCCGAAAGAAGTAGCGAACAAGTGTCCCTTAAGCTCCTTTAGCTTCTTCAAGACAAAGGAAGTCCCTACCGGTTTCTTCGAAATCAAGACTGGTTC
GCTAAATATCCGTACACCTTGGTG
GTAATTATTTTATTCTAGACCTATCATATAAAATCATTAAAATGTGTTGCTATACACGTTTTTTTCTGGCTTAAACATTTTTGTGGGATCGGTTAA
GATCAAAAAAAAAAAAAATTCTTGTGTGGGGATATATGGACGACGTAAACACACATATTCATGCATACAAATCATACATTTAATTATATATGATGACTACAAATAATTCAACGAAATATT
AATAAATTAGGGATTCGAGCGTCATCTATGGAAGCAACTCGAAAATATTGGATAGAGTAAGAACTTACAAAGATGGGAAACTGAAGATATCGGAGGAGACGGGTCTCCTTCTCCATGACG
AAGACGGGTTAGCTATCTCCGGCGATATTCGTAACAGTTGGGTTGGCGTCTCCGCTTTGCAAGCTCTCTTCATCAAAGAGCACAACGCTGTATGCGACGCCCTCAAG
GTTCAATATTTGT
TTCTCTTTTTTTAGAAAATGTAAATTACGAAATTTGAATAATTTTTGTGCCAGTTTGAAAATTTTTATTCAAAATAGGATGAGGATAAGGATTTGGAAGACGAAGATTTGTACCGGTACG
CGAGGCTAGTGACTTCAGCGGTGATAGCCAAGATTCACACCATAGATTGGACAGTCCAGCTTCTCAAAACCGACACTTTACTTGCTGGGATGAGAGCAAATTG
GTCAATACCACATTTTT
GTTCTTTTCCATCTATGATTTTCACGTTACGTATCACATATGTTGCAATATCTAACACTTTTAATATTTTGTGATTTTAGGTACGGACTACTAGGAAAGAAGTTTAAAGATTCTTTCGGA
CATGCAGGAAGTTCGATCTTGGGAGGTGTCGTGGGAATGAAGAAACCGCAAAATCATGGGGTCCCTTACTCTCTAACCGAGGATTTCACTAGCGTCTATCGAATGCACTCTCTCTTACCT
GATCATCTCCAGATGCGTGACATTGATGATGTACCAGGAGCTAATAAATCACTACCGTTGATTAAAGA
GTATAACTCTATACTTTATACATCTCTCTCTCTCTCCTATTTTGAAGTTTTC
AATTTTATAAAAGTTTTAGTGTTTTATTATTTCTTTGGATTTAGGATTTCTATGGGAAATTTGATTGGTCGTAAGGGAGAAGAAACCATGTCTCAGATTGGATTCACTAAGCTAATGGTC
TCAATGGGTCACCAAGCAAGTGGTGCCCTTGAACTGATGAATTATCCAATGTGGTTAAGAGACATTGTTCCCCAAGACCCCAACGGCCAAGATCGTCCGGACCACGTCGACTTAGCTGCT
TTAGAGA
GTAAGTCAATGTGATCCCAGCCGTTCATTGTGGTTTGACTTGATTCTCACGTGAATTCGGTTTGTCGATTATTTTAGTCTATAGGGACAGGGAGAGGAACGTCCCACGGTACA
ACGATTTCAGGAGAGCCATGTTTATGATTCCGATAACCAAGTGGGAAGATCTAACGGATGATGAGGAAGCTATTAAAGTGTTGGATGACGTGTACGATGGTGATGTGGAGGAGCTTGATC
TTCTCGTGGGACTTATGGCAGAGAAGAAAATCAAAGGTTTTGCTATCAGTGAGACTGCTTTTTACATTTTCATCATCATGGCCACAAG
GTATATATTTGGTTCTTATAAATGAATTAAAG
ATTTAATATATAAAACCAAGTTTTCTTGAAGATATTATAGTAAACTAGAAACTAAAAGCTTAATTAATCTAATGCTAATTTTAACATTTCAGGCGATTAGAAGCGGATAGGTTTTTCACG
AGTGATTTCAATGAAACGATTTATTCGAAGAAGGGGCTTGAATGGGTGAATACTACAGAGAGTCTCAAGGATGTGTTTGATCGTCATTATCCTGAAATGACTGATAAATGGATGAACTCT
GAAAGTGCATTTTCGGTATGGGATTCACCTCCAGTTACCAAAAATCCAATCCCTCTCTATCTCCGAATTCCTTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCAATTACTTCTCTAATCTCTTCTGTTTTGCTTAAATTTATCCACGAAGACTTTCATGAGATTTACTCAAGAATGTCCCTCCTCGATCGTTTTCTACTTCTTATCGTGCATGCA
GTGGATAAGATGGTTCCATGGCATAAGCTTCCGGTTTTCTTGGGTTTAGCCTATCTTGAAGTACGTAGACATCTTCACCAAGAATACAATCTTATCAACGTGGGTCAAAGTCCGGTTGGG
ACCCGGTTTGATCCTGCTAATTATCCGTACCGGACTGCTGACGGAAAATTCAATGATCCGTTTAATGAAGGCGTCGGCAGTCAAAATAGCTTCTTCGGAAGAAATTGTCCCCCCGTCGAT
CAGATAACAAAG
TTACTGAGGCCAGACCCCATGGTGGTGGCGTCAAAACTATTAGGAAGGAGAAAGTTTATTGACACAGGAAAACAATTCAATATGATCGCAGCTTCTTGGATTCAATTC
ATGATCCATGATTGGATTGATCATCTTGAAGATACTCGCCAA
ATCGAGCTTGTGGCTCCGAAAGAAGTAGCGAACAAGTGTCCCTTAAGCTCCTTTAGCTTCTTCAAGACAAAGGAAGTC
CCTACCGGTTTCTTCGAAATCAAGACTGGTTCGCTAAATATCCGTACACCTTGGTG
GGATTCGAGCGTCATCTATGGAAGCAACTCGAAAATATTGGATAGAGTAAGAACTTACAAAGAT
GGGAAACTGAAGATATCGGAGGAGACGGGTCTCCTTCTCCATGACGAAGACGGGTTAGCTATCTCCGGCGATATTCGTAACAGTTGGGTTGGCGTCTCCGCTTTGCAAGCTCTCTTCATC
AAAGAGCACAACGCTGTATGCGACGCCCTCAAG
GATGAGGATAAGGATTTGGAAGACGAAGATTTGTACCGGTACGCGAGGCTAGTGACTTCAGCGGTGATAGCCAAGATTCACACCATA
GATTGGACAGTCCAGCTTCTCAAAACCGACACTTTACTTGCTGGGATGAGAGCAAATTG
GTACGGACTACTAGGAAAGAAGTTTAAAGATTCTTTCGGACATGCAGGAAGTTCGATCTTG
GGAGGTGTCGTGGGAATGAAGAAACCGCAAAATCATGGGGTCCCTTACTCTCTAACCGAGGATTTCACTAGCGTCTATCGAATGCACTCTCTCTTACCTGATCATCTCCAGATGCGTGAC
ATTGATGATGTACCAGGAGCTAATAAATCACTACCGTTGATTAAAGA
GATTTCTATGGGAAATTTGATTGGTCGTAAGGGAGAAGAAACCATGTCTCAGATTGGATTCACTAAGCTAATG
GTCTCAATGGGTCACCAAGCAAGTGGTGCCCTTGAACTGATGAATTATCCAATGTGGTTAAGAGACATTGTTCCCCAAGACCCCAACGGCCAAGATCGTCCGGACCACGTCGACTTAGCT
GCTTTAGAGA
TCTATAGGGACAGGGAGAGGAACGTCCCACGGTACAACGATTTCAGGAGAGCCATGTTTATGATTCCGATAACCAAGTGGGAAGATCTAACGGATGATGAGGAAGCTATT
AAAGTGTTGGATGACGTGTACGATGGTGATGTGGAGGAGCTTGATCTTCTCGTGGGACTTATGGCAGAGAAGAAAATCAAAGGTTTTGCTATCAGTGAGACTGCTTTTTACATTTTCATC
ATCATGGCCACAAG
GCGATTAGAAGCGGATAGGTTTTTCACGAGTGATTTCAATGAAACGATTTATTCGAAGAAGGGGCTTGAATGGGTGAATACTACAGAGAGTCTCAAGGATGTGTTT
GATCGTCATTATCCTGAAATGACTGATAAATGGATGAACTCTGAAAGTGCATTTTCGGTATGGGATTCACCTCCAGTTACCAAAAATCCAATCCCTCTCTATCTCCGAATTCCTTCTTAG

Retrieve as FASTA