Entry information : Aly1CysPrx
Entry ID 7468
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: Aly1CysPrx
Name Aly1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Aly1CysPrx
start..stop
S start..stop
Ahal1CysPrx01 442 4e-161 1..216 1..216
Crub1CysPrx01 436 9e-159 1..216 1..216
At1CysPrx 433 2e-157 1..216 1..216
Bstr1CysPrx01 425 2e-154 1..216 1..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24434964..24435081 118 N° 2 24435154..24435302 149 N° 3 24435412..24435540 129 N° 4 24435606..24435860 255
join(24434964..24435081,24435154..24435302,24435412..24435540,24435606..24435860 )


exon

Literature and cross-references Aly1CysPrx
DNA ref. Phytozome 11:   scaffold_1 (24434964..24435860)
Protein sequence: Aly1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   23873.16  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGITLGDTVPNLEVETTNGTFKLHDYFADSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHKDWIKDIEAFHGSKVKYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTTGRNMDEVLRALDSLLMASKHNNKIATPVNWKPDEPVVISPAVSDEEAKKMFPQGFKTADLPSKKGYLRHTQVS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGATCACACTAGGAGACACGGTACCGAACCTAGAAGTGGAGACGACAAATGGCACGTTCAAGCTTCATGACTACTTTGCCGATTCTTGGACCGTCCTCTTCTCTCATCCCGGT
ATATAGTTTATTATTATGACTTTTGTTACATTCTAGTTTATTTTCTTAATTTTTGTCGATGGACACACAGGGGATTTCACACCGGTATGCACCACGGAGCTTGGTGCGATGGCGAAATAC
GCTCATGAGTTCGATAAGAGAGGCGTGAAGCTCCTTGGGTTGTCTTGTGACGATGTACAGTCACACAAAGACTGGATCAAAGACATCGAAGCTTTTACG
GTATACCTTAATAAATCTCTC
ATGCATGCATACAAAACCTATTAATCTTTGATCTAGCTAGAGATCATATTTTGCTTTTGATTAATTTGTTACATATGTATGGATATAGCACGGAAGCAAGGTGAAGTACCCTATAATCGC
TGACCCGAACAAAGAGATCATTCCTCAGCTTAACATGATTGATCCAATCGAGAATGGACCGTCTCGTGCCCTTCATATTGTTGGTCCTGATAGCAAG
GTAATAATTTCATATTTTATTCC
ATGTATGATTTTATTGGTTAATTTTGGATTTGTGATATATAGATAAAGTTGAGCTTCTTGTATCCGTCGACCACGGGACGTAACATGGACGAAGTATTGAGGGCTTTAGACTCGTTGTTG
ATGGCGTCCAAGCACAATAACAAGATCGCCACTCCGGTTAACTGGAAACCGGATGAACCGGTTGTGATTTCGCCTGCCGTGTCTGACGAAGAAGCCAAAAAGATGTTTCCCCAGGGTTTC
AAGACCGCCGATCTTCCGTCAAAGAAAGGCTATCTGCGTCACACTCAGGTCTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGGATCACACTAGGAGACACGGTACCGAACCTAGAAGTGGAGACGACAAATGGCACGTTCAAGCTTCATGACTACTTTGCCGATTCTTGGACCGTCCTCTTCTCTCATCCCGGG
GATTTCACACCGGTATGCACCACGGAGCTTGGTGCGATGGCGAAATACGCTCATGAGTTCGATAAGAGAGGCGTGAAGCTCCTTGGGTTGTCTTGTGACGATGTACAGTCACACAAAGAC
TGGATCAAAGACATCGAAGCTTTTACG
CACGGAAGCAAGGTGAAGTACCCTATAATCGCTGACCCGAACAAAGAGATCATTCCTCAGCTTAACATGATTGATCCAATCGAGAATGGACCG
TCTCGTGCCCTTCATATTGTTGGTCCTGATAGCAAG
ATAAAGTTGAGCTTCTTGTATCCGTCGACCACGGGACGTAACATGGACGAAGTATTGAGGGCTTTAGACTCGTTGTTGATGGCG
TCCAAGCACAATAACAAGATCGCCACTCCGGTTAACTGGAAACCGGATGAACCGGTTGTGATTTCGCCTGCCGTGTCTGACGAAGAAGCCAAAAAGATGTTTCCCCAGGGTTTCAAGACC
GCCGATCTTCCGTCAAAGAAAGGCTATCTGCGTCACACTCAGGTCTCTTGA

Retrieve as FASTA