Entry information : AlyPrxQ
Entry ID 7469
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrxQ
Name AlyPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrxQ
start..stop
S start..stop
AtPrxQ 407 2e-147 1..216 1..216
AhalPrxQ01 363 2e-130 40..216 1..177
ThasPrxQ01 335 1e-118 3..216 2..216
AdePrxQ 301 2e-105 6..212 4..210
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2637576..2637779 204 N° 2 2638217..2638354 138 N° 3 2638444..2638533 90 N° 4 2638624..2638842 219
join(2637576..2637779,2638217..2638354,2638444..2638533,2638624..2638842)


exon

Literature and cross-references AlyPrxQ
DNA ref. Phytozome 11:   scaffold_5 (2637576..2638842)
Protein sequence: AlyPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   23668.21  
PI (pH):   %s   10.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSSSFTLCNHTTLHTLPQRKTLVTKTHFSVPTKSSESNFFGSRLTHSSYLSPVSSSSLKSLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADESPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCATCTTCCTCTTTCACTCTCTGTAATCACACCACACTTCACACTCTCCCTCAGAGAAAGACCCTTGTCACCAAAACCCATTTTTCTGTTCCCACAAAATCATCAGAATCT
AATTTCTTTGGCTCCAGACTCACTCACTCGTCGTATCTCTCCCCAGTCTCTTCCTCTTCTCTCAAAAGCTTAATCTTTGCCAAG
GTACATTTCACGAATCTTGCATTGATAGATTGTTTG
CTACAATTGGGTAACAACTAGTTCTGGGAATTAGCTTCTTTGTTAGACCAATGTTGTTTGGACAATTTTAGTTGTGTTCCTAGACAACTTCTGTAGTAATCTCTGCCAACTTTTTCTTAT
ATGTTTTTGCCTTCGATCCCAAGATATACATGGAAAAATTGAGTATTTTGGGTCTGAATTTGAATGTTATGATGATAGATTCATGAATGTGTTAGTGCAGAACCAAAGACAAAATCAAAG
AAAATTGCAATCAGTGTTTGTTTTAGAGACCATAAACTTTCACATACCTCAAAGAAAATGCTAGAATGCTCTTGAAATATTCAATCCTCTATTAGATTATCTCTGAACTCTCTTTAACCT
TCTTTGAATTGTTCTTTTTTGTGATGCTTTGTGGGCAGCAGGTTAACAAGGGTCAGGCTGCACCAGACTTCACACTCAAGGATCAGAACGGAAAGCCGGTGAGCCTCAAGAAGTATAAAG
GGAAGCCTGTTGTTCTCTACTTCTACCCTGCAGATGAAAGCCCTGGCTGCACCAAACAG
GTCTTTCATTTTTACTCTCTTCTCTTTTCTGCATTCATCGCGCGTATTTAGTGTTGTTAAA
CGTAAATGGTTTTATTTTTATACGACAGGCTTGTGCTTTCAGAGACTCTTATGAGAAATTCAAGAAAGCCGGTGCAGAGGTCATTGGGATTAGTGGTGATGACTCTGCTTCTCACAAGGT
ACACACATCATAAGCTGATTTCTGAATAAAAAACCGATGTTGTTTTACGGGTTTTAAAGAGGGTTTGGGACTTCAAACATTGTTGCAGGCGTTTGCAAGCAAATACAAGCTGCCGTATAC
ATTGTTAAGCGACGAAGGGAATAAGGTGAGAAAAGATTGGGGAGTACCAGGAGACTTGTTTGGGGCATTGCCAGGGAGACAAACTTACGTCCTTGACAAAAACGGTGTTGTTCAGCTCAT
CTACAACAACCAGTTCCAGCCTGAGAAACACATTGACGAGACCTTGAAGTTTCTTAAAGCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCATCTTCCTCTTTCACTCTCTGTAATCACACCACACTTCACACTCTCCCTCAGAGAAAGACCCTTGTCACCAAAACCCATTTTTCTGTTCCCACAAAATCATCAGAATCT
AATTTCTTTGGCTCCAGACTCACTCACTCGTCGTATCTCTCCCCAGTCTCTTCCTCTTCTCTCAAAAGCTTAATCTTTGCCAAG
GTTAACAAGGGTCAGGCTGCACCAGACTTCACACTC
AAGGATCAGAACGGAAAGCCGGTGAGCCTCAAGAAGTATAAAGGGAAGCCTGTTGTTCTCTACTTCTACCCTGCAGATGAAAGCCCTGGCTGCACCAAACAG
GCTTGTGCTTTCAGAGAC
TCTTATGAGAAATTCAAGAAAGCCGGTGCAGAGGTCATTGGGATTAGTGGTGATGACTCTGCTTCTCACAAG
GCGTTTGCAAGCAAATACAAGCTGCCGTATACATTGTTAAGCGACGAA
GGGAATAAGGTGAGAAAAGATTGGGGAGTACCAGGAGACTTGTTTGGGGCATTGCCAGGGAGACAAACTTACGTCCTTGACAAAAACGGTGTTGTTCAGCTCATCTACAACAACCAGTTC
CAGCCTGAGAAACACATTGACGAGACCTTGAAGTTTCTTAAAGCTGCTTGA

Retrieve as FASTA