Entry information : Aly2CysPrx01 (Aly2CysPrxA)
Entry ID 7470
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: Aly2CysPrx01 (Aly2CysPrxA)
Name (synonym) Aly2CysPrx01 (Aly2CysPrxA)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Aly2CysPrx01
start..stop
S start..stop
At2CysPrx01 459 4e-166 1..265 1..266
So2CysPrx 446 6e-161 1..265 1..265
Bn2CysPrxB-2_other 435 7e-157 1..265 1..262
Br2CysPrx02_other 427 1e-153 1..265 1..268
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4664761..4664967 207 N° 2 4665293..4665367 75 N° 3 4665548..4665628 81 N° 4 4665720..4665797 78
N° 5 4665920..4666045 126 N° 6 4666133..4666246 114 N° 7 4666324..4666440 117  
join(4664761..4664967,4665293..4665367,4665548..4665628,4665720..4665797,4665920 ..4666045,4666133..4666246,4666324..4666440)


exon

Literature and cross-references Aly2CysPrx01 (Aly2CysPrxA)
DNA ref. Phytozome 11:   scaffold_3 (4664761..4666440)
Protein sequence: Aly2CysPrx01 (Aly2CysPrxA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265
PWM (Da):   %s   28786.79  
PI (pH):   %s   6.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLASSTTLISSPSSRVFPAKSSLSSPSVSFLPTLSSPSASASLRSGFAQRSSLSSTSRRSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTITAFSDRHSEFEKLNTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTCTAGCTTCTTCAACTACTCTCATATCTTCTCCATCTTCTAGGGTTTTTCCAGCAAAGTCTTCACTTTCCTCTCCATCTGTTTCTTTCCTTCCAACCCTTTCCTCTCCTTCC
GCATCTGCTTCTCTCCGCTCCGGCTTCGCTCAACGCTCTTCCCTCAGCTCCACTTCTCGCCGGAGCTTTGCTGTCAAAGCCCAGGCC
GTAAGTTTATCTCAATGTCGATACTTTTCTTAT
TCTGTCTCATTGGAATCTGAATTCATTAGCCTGTTATAGAATTCACTCTCTTCCTACTTGTTAGCCCTATAAATAATTATCGATTTATAGGTTTCTGCAGATTACTCTAAAAATTCGGAA
ATTTGAGTGACATTTTCTTTTGGGGTTGTTAATTGAGTGACATTTGAGCTATACTCGTTGACTGATTTTAGTCTGTAAGAGGAGTCCTATGTAGTTTTGGTCTGATTGTTGATTTGACTG
ATCCTGCTCCTTGTATTTGATGTGTAAACGAGCTTTACTTTTGTGTTTATAGGATGATCTTCCACTGGTTGGAAACAAGGCGCCTGATTTCGAGGCAGAGGCTGTGTTTGATCAGGAGTT
CATCAAG
GTATCATCTCTAAAGAAGCTTCTTTTTCTATATTGACTAGTTTACTTATAGCAAATGTTAATCATAGCTGCTGCTGCTTCTAGTTAATCTGAGACATCAATTTAGGTTTGAAG
CTAAATGACTAGTATGTTTCTTATTCTTCTCGAAACTAAGTGGTAACTGATGAATGTATGGTTTCAGGTTAAGCTCTCTGAGTACATTGGAAAGAAGTATGTGATTCTCTTTTTCTACCC
ATTGGACTTCACTTTCGTCTGCCCAACA
GGTTAAAATCGCTCGAGAAGTTGATCAAAATTGAATGTCTGAGGGTCGCTGCGTCCTAATCTCTTTTCTGTTTTTCTTATGTCTTCTAGAGA
TTACTGCCTTCAGTGACCGGCATTCAGAATTTGAGAAGTTGAACACCGAAATATTAGGTGTTTCTGTCGATAGTGTG
GTAAGTATAACTATACAATTACTATCTTATTTTACTCAGTTTC
TCATCCTTGGTTGACATCACCATGTTCTTACCTGTTTGCAAATTGTTTGACTCATCATTACTTGTGTGTGTCCACGTAGTTCTCTCACCTTGCATGGGTCCAAACAGACAGGAAATCGGG
AGGGCTTGGTGATCTGAACTATCCCCTTATTTCAGATGTCACTAAATCAATCTCAAAATCTTTTGGAGTGCTCATCCATGATCAG
GTAATTGTTATCCTTTAGATGTTGGCTACCTTACT
TTCGAAGTGTTTGAGATAAATAGAGACAAGAACTTCGTTTGTGTAAGAACAGGGAATAGCACTGAGAGGGCTCTTCATAATTGACAAGGAAGGAGTGATCCAACATTCCACCATCAACAA
TCTTGGTATTGGCCGAAGCGTTGATGAGACAATGAGAACCCTCCAG
GTAATAGAAACAAAGAAATTACGAACTCCGAAAACGCTCCAATTGCGGTTTACTTAAATGTATTCTCAATGTTG
CAGGCATTACAGTACATCCAAGAAAACCCGGATGAGGTCTGCCCAGCGGGATGGAAGCCGGGTGAGAAGTCAATGAAACCTGACCCGAAACTCAGCAAAGAGTACTTCTCAGCTATTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTCTAGCTTCTTCAACTACTCTCATATCTTCTCCATCTTCTAGGGTTTTTCCAGCAAAGTCTTCACTTTCCTCTCCATCTGTTTCTTTCCTTCCAACCCTTTCCTCTCCTTCC
GCATCTGCTTCTCTCCGCTCCGGCTTCGCTCAACGCTCTTCCCTCAGCTCCACTTCTCGCCGGAGCTTTGCTGTCAAAGCCCAGGCC
GATGATCTTCCACTGGTTGGAAACAAGGCGCCT
GATTTCGAGGCAGAGGCTGTGTTTGATCAGGAGTTCATCAAG
GTTAAGCTCTCTGAGTACATTGGAAAGAAGTATGTGATTCTCTTTTTCTACCCATTGGACTTCACTTTCGTCTGCCCA
ACA
ATTACTGCCTTCAGTGACCGGCATTCAGAATTTGAGAAGTTGAACACCGAAATATTAGGTGTTTCTGTCGATAGTGTGTTCTCTCACCTTGCATGGGTCCAAACAGACAGGAAATCG
GGAGGGCTTGGTGATCTGAACTATCCCCTTATTTCAGATGTCACTAAATCAATCTCAAAATCTTTTGGAGTGCTCATCCATGATCAG
GGAATAGCACTGAGAGGGCTCTTCATAATTGAC
AAGGAAGGAGTGATCCAACATTCCACCATCAACAATCTTGGTATTGGCCGAAGCGTTGATGAGACAATGAGAACCCTCCAG
GCATTACAGTACATCCAAGAAAACCCGGATGAGGTCTGC
CCAGCGGGATGGAAGCCGGGTGAGAAGTCAATGAAACCTGACCCGAAACTCAGCAAAGAGTACTTCTCAGCTATTTAG

Retrieve as FASTA