Entry information : Aly2CysPrx
Entry ID 7471
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2015-06-03 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: Aly2CysPrx
Name Aly2CysPrx
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Aly2CysPrx
start..stop
S start..stop
Bn2CysPrxB-2_other 448 7e-162 1..264 1..262
Bn2CysPrxB-1_other 438 9e-158 1..264 1..270
Thas2CysPrx02 437 4e-157 2..264 23..278
At2CysPrx02 436 5e-157 50..264 59..273
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2360169..2360369 201 N° 2 2360696..2360770 75 N° 3 2360891..2360972 82 N° 4 2361059..2361138 80
N° 5 2361334..2361459 126 N° 6 2361583..2361696 114 N° 7 2361804..2361920 117  
join(2360169..2360369,2360696..2360770,2360891..2360972,2361059..2361138,2361334 ..2361459,2361583..2361696,2361804..2361920)


exon

Literature and cross-references Aly2CysPrx
DNA ref. Phytozome 11:   scaffold_6 (2360169..2361920)
Protein sequence: Aly2CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265
PWM (Da):   %s   28995.03  
PI (pH):   %s   5.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIASSSTTTLISSSRVLLPSKSSLLSPAVSFPRTFASSSSGFSRLVPLTSRLSASRRSFVVKAQALPLVGNKAPDFEAEAVFDQEFIKVLLSEYIGKKYVILFFYPLDFTFVCPTG*SAFSDRYEEFEKLNTEVLGVSVDSVVHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQVNALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQVNQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 6 introns).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
nnnnnnnnnn nnnnnCTTAT TCTCATAACC ATCTTATCAA GAATTCGATT CGATTTGCAG GATCTTGGTG GCTCTTCTTA CTGTTTTCGA AAGGATAGGA GACATCATTG TATCATGGTT  AGTACTACTT AGTAGTAGAT CATTTGATAC TTTTGTATCA AACCTTTTGA TTCATCTAAC CGTAGGTTAC CACTCTACGG TGAGATCAAA ATCGCTCTTC TCGTCTACTT ATGGTACCCG  AAATCACAGG TCATACTACA ATGCAAGAAA AATCTCATGA GCATTCATTC TTTGATTCAC AAAACCAATC TTCTTCTCTT GGTTTCTGAC AGGGACTTAG CTATGTCTAT GAGAAGCTAC  TATGTCCATA CATGTCAAAG CATGAATCGG ACATCGATCA AGGAATCTCC GTCTTAAAGA TAAGAGGACA TTTAGTAATT GCTCAACTAC TGCAATGTGG CTTCCACTGG AGCCTCCAAA  TCTTCAAGCA ATTGCAACAA CAATTCACCA TCGATAAGGT TTAAAACAAA CATATACATT CTCAAATCCC ATTTCATGAA ATCAAGAAGC TACTCTCACC AAATCCTTTC ACTTCTTTAT  CTGCAGAATA ATAACCCATC AAAGTCAAAA GATCAACCAC AAACAAGAAC TTCGTTTATG TTTCTCCGTT AGAAGATACT GCTCTACTCT AAGCCACAAT CTCAATAACC GGGTTTTTAT  CCGCCGGTTC ACCGGAATTG GCAGCCAAAC CGGAGTTTCT ACATGATTCA GAGTTCAGAT TGACCTGACC ACTACTAATA ATTGACGAAC GAAAGAAAAA GATTTTGAAG AATTCAGAAA  TCGAATTTTT TTCATTTTAC ATATTTTGAA TTTTATTGTA TACAAACAGA TTTTTGTTCA ATTCATGAAA TCCAATTATT ATCCAATTTC TCTTCGAGAA TTTTATCCCC AAATCAAAAT  TTATATGAAC TATTTGACAA TCAAAGGAAC ACGAATCGAT TGAAAAATCC AATCAAATAC ACGTCTCAAG AACCGAATTC CGGCGGATAA ATGAATCCAT ACACGGCGGA GGAATTGAGA  ACCAGCAGAA TCCTCCGACG AAGTAAGCAC CGTTGGTTGA AGATAAGACA AAGCAGCTTT CTTAACGAGA CGGTTACGAA TCGAGATATC TCCGGCGGTG GATGTAACCG GAGAGAAGCT  ACCGTTGATC GTCGGTAAAT TGAGTGAAGA GTTACTCGGA GAAGAGATGA TATCTCTGAG AGAAGTGTAA GCTACGAAAG AGGATGGTTT TATGGAGATG AGCTCATAAT CGAACGAAGA  CGGCGGCGTT GAAGCCATGT CGAAAGGGAT TTCGGGAGGA GTCAAAGTCG TCATGGTGGA TATGGATTTT GTACGACGGA GTGGCGTCGC CGGAGATTGT GACGGCGGAA TCTCCATAGT  CTTCTCTTTT TGTTTTTGTG GCTGATTAGG TTTGTGAGTG TGTAAATAAG GAGGTTCAAT AATTGATCTC TATAATATGA ACATTAGTCA CTATCTTGTG TATATTATTA ATACTTAATT  TGTATTTTCT TAATTATTAT GATTGGAAGA TAGACAAATT ACAAAATTTA AGGATTGTTT ACTATTCTTT GTCCATTATT CTATTTTTGA TGAGAAGATT AGATGGAAAT ATATTCGGAA  TCCAACCAAC ATAATGAAAA CCAATGTAGA CTTTTTAACA TTTTGATATA CTACTAATTA TTAAAGTATG ATGATCCACT TATTCACTTA CCGCGTCAAA CGGTGTCGTT CCGGTACATC  GAACATTCCA CTGCTTTTCA ACTGTACTAA AGAAAAATCT AGAAACAGCA TTTGGTTTCT CTCTATCCGC TTTGTCTCTC TCTCTCACGC CCTCACGTTT GTCCACCTCA TCATAATCGA 
AACCAATCAC AAGAACCCTT TTTTAGAGTA CTGTAACTAG TGACGCGGAG AGAGAGAGAA CACAGTCACA GAGTTATGTC A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGCTAAAAC TGAACAATTG TTTGGTGAAA ATTTGCAAGC AGAGTTGTTT TATTAATCTT TTCTAAGTTG GAGCAGAGTT GTTAATTTTC GCCAAAGAAC CTTTGTATCT CATTTTTCTG  CTATGTGATT CTCCTGAAAT TGAATAAAAG ATAAAAATAA ATCTTCTCTT TCTTTTTTCC AATGTTGATG TCTTTCACTT CTGTAAATAG TTTATACTAA TCCAAAGAGG CAGAGTATTT  GACCAAGGCA ACATAAATTA GAAAAATAAC ATGTGAGGTC ACAGGTCTCT GGAATTAGAC AACTATCTGA TTGATTTGTT TAATAAACTT GAGTGCTCAT TAAGCTAATC TCCATCTTTA  GCCGACAACA AAATTAAGTT GTAGTATACG TATTACACGG AATATTCTAC AATCGGATTA CTAAAAAATT ATCGTATGAT AACTTTCGTT AAAAGAAAAA TTTTGAATTC TTAAAATAAA  TATATCTTGA CACGAGAAAA AAGGAAAAAC ACAATAGAAG GTATGAATAA AAAATATTAG AACCAAAAAA AGAAAAGGAT CGTTTTGTCA TTTGTTGATA ATAGGCCCTA CCCTTCATTT  TTTCCATTAA ACCAAAATGT ACAAAGACAA GTGGGGATGA TGGGGTTTGG TATATACGCG GTTAGCAGTT ACCCACGTGG TTTATCCACT TCACACATTT AACCACCCCT ACAAAATAAT  GTTATCAAAA CGACCCCAAT ACTTTCTTTT GTCTTCTTTC CGACCTTTCC TTCTGATGTT AAAAAACTTT AATTCCGCTG TACACTGCTT TTACCCAAAA ATAAACTCCC CATATTATAT  TCTTACGTAG CGGTAGCAAC CTCCGAACCC GGTACATAGC TGAGCCGGTC CACTTCATCC CAAACCAATT TCGAGGTTAT CTCATCGAAC TCCGGTTCAT ATTCCTACAA CAACATGAAC 
CATGTCCACA AGTATATATT GGTATGAGAC TTTCGATTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTATAGCTTCTTCTTCCACCACCACCCTTATCTCTTCCTCTAGGGTTCTTCTTCCCTCCAAGTCTTCTCTTTTATCTCCCGCCGTGTCTTTCCCCCGAACCTTCGCATCATCC
TCTTCCGGATTCTCTCGTCTCGTTCCCCTAACCTCCAGACTCTCCGCCTCACGCCGGAGCTTCGTCGTCAAGGCACAGGCT
GTAAGTTGACTCGCATTGCCATCAATTTATCGTATTTGC
TCCCTGTTTTGGGTTTTGAGATCTTTGGATAAAAAACTAAACTTTTTAGAGTTCTGCAACTGTGGAAGTCTTGAATTGAGCGACATTTTGATTACCCTTCTTTTTGAATTACTGTAATTG
CAAATGGAGAAAGTGCCCTGAATTTTGTATAATTGACTCATACACAGAAATCTTTTGAGCCGTACTTAGCGAAATAAGACCAGCTAAAGCCTAAAGCGCTTATTTTTGTGGCAGAAGTTA
ACAACTTTATGATCAATGTGTGACGAGTTTTATGAATTCAGGATGATTTACCATTGGTCGGTAATAAGGCGCCTGATTTTGAGGCAGAGGCAGTTTTTGATCAAGAGTTTATAAAGGTAC
TT
TCACTCCATATAACCTTCTTTAACATGTGTTTAGACCAATTCTGGTGCTTCCAGTAGCTTAGGTCAATGCAGTAGAGGAATGTTGTGATAGTAATCGACCTATTATGGTTTCAGGTGA
AGCTCTCTGAGTACATTGGGAAAAAGTACGTGATTCTATTTTTCTACCCATTGGACTTCACTTTCGTTTGCCCCACAGGTTAGTATTGCTGAGGAAATAGCTTCAAAACTGAAACTCTCG
CCTCAAAGTCACTGAATTTTCCTATTTTTCTTTGCTTATTCTAGAGATTACTGCCTTCAGTGACCGTTATGAAGAATTTGAGAAGCTAAACACCGAAGTATTAGGGGTCTCAGTCGACAG
TGTGGTATAG
TATTTATATTTTCTCCCCCTGACCCTTGTGGTCTCAGCATTTTGAGAAATGGTTTTAAGTATTTGATGGACATAAGTTGGAATTTGAAAATGGCTAATTTTAGTCCTAGC
TTTGGCAAGTGGCAGTCTGATAATCAATTGATCTCATTTTCTTTTGGATAATGCAACGCTTGATTCAATGTTCATGTAGTTCTCGCATCTCGCGTGGGTCCAAACAGACAGAAAATCGGG
TGGGCTCGGTGATCTGAATTACCCGCTTGTTTCAGATATCACTAAATCCATTTCAAAATCGTTTGGAGTGCTCATCCCTGACCAGGTAAAC
GATTTCTTCCCACATAGTTGCATCTACTT
GCATTGAGTCCAATCCACTTGTGTTCTTTAAAGTAGCAACAACTTTCAGCCACTTTGAATTGAAGCATTTTGCTACATACAAGTACAGGGCATTGCACTGAGGGGACTTTTCATCATCGA
CAAGGAAGGAGTCATTCAGCATTCCACCATCAACAACCTTGGTATTGGTCGAAGTGTTGATGAGACAATGAGAACCCTCCAGGTAAAT
AAAGAACAAAAACAACATTGAGATAGATAGAA
AGAGATATGTTTTTTGCGGTTTAGGGTTTAGATGCGTTACGTGTTGCTCCTTGCGATGTTGTCTTGCAGGCATTACAGTATGTTCAAGAAAACCCGGATGAAGTTTGCCCTGCGGGATGG
AAGCCCGGGGAGAAATCAATGAAACCTGACCCCAAGCTCAGCAAAGAATACTTTTCAGCTATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCTATAGCTTCTTCTTCCACCACCACCCTTATCTCTTCCTCTAGGGTTCTTCTTCCCTCCAAGTCTTCTCTTTTATCTCCCGCCGTGTCTTTCCCCCGAACCTTCGCATCATCC
TCTTCCGGATTCTCTCGTCTCGTTCCCCTAACCTCCAGACTCTCCGCCTCACGCCGGAGCTTCGTCGTCAAGGCACAGGCT
TTACCATTGGTCGGTAATAAGGCGCCTGATTTTGAGGCA
GAGGCAGTTTTTGATCAAGAGTTTATAAAGGTACTT
CTCTCTGAGTACATTGGGAAAAAGTACGTGATTCTATTTTTCTACCCATTGGACTTCACTTTCGTTTGCCCCACAGGTTAGTCT
GCCTTCAGTGACCGTTATGAAGAATTTGAGAAGCTAAACACCGAAGTATTAGGGGTCTCAGTCGACAGTGTGGTATAG
CATCTCGCGTGGGTCCAAACAGACAGAAAATCGGGTGGGCTC
GGTGATCTGAATTACCCGCTTGTTTCAGATATCACTAAATCCATTTCAAAATCGTTTGGAGTGCTCATCCCTGACCAGGTAAAC
GCACTGAGGGGACTTTTCATCATCGACAAGGAAGGA
GTCATTCAGCATTCCACCATCAACAACCTTGGTATTGGTCGAAGTGTTGATGAGACAATGAGAACCCTCCAGGTAAAT
CAGTATGTTCAAGAAAACCCGGATGAAGTTTGCCCTGCGGGA
TGGAAGCCCGGGGAGAAATCAATGAAACCTGACCCCAAGCTCAGCAAAGAATACTTTTCAGCTATCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACACAGTCAC AGAGTTATGT CAATGGCGTC TATAGCTTCT TCTTCCACCA CCACCCTTAT CTCTTCCTCT AGGGTTCTTC TTCCCTCCAA GTCTTCTCTT TTATCTCCCG CCGTGTCTTT  CCCCCGAACC TTCGCATCAT CCTCTTCCGG ATTCTCTCGT CTCGTTCCCC TAACCTCCAG ACTCTCCGCC TCACGCCGGA GCTTCGTCGT CAAGGCACAG GCTGATGATT TACCATTGGT  CGGTAATAAG GCGCCTGATT TTGAGGCAGA GGCAGTTTTT GATCAAGAGT TTATAAAGGT GAAGCTCTCT GAGTACATTG GGAAAAAGTA CGTGATTCTA TTTTTCTACC CATTGGACTT  CACTTTCGTT TGCCCCACAG AGATTACTGC CTTCAGTGAC CGTTATGAAG AATTTGAGAA GCTAAACACC GAAGTATTAG GGGTCTCAGT CGACAGTGTG TTCTCGCATC TCGCGTGGGT  CCAAACAGAC AGAAAATCGG GTGGGCTCGG TGATCTGAAT TACCCGCTTG TTTCAGATAT CACTAAATCC ATTTCAAAAT CGTTTGGAGT GCTCATCCCT GACCAGGGCA TTGCACTGAG  GGGACTTTTC ATCATCGACA AGGAAGGAGT CATTCAGCAT TCCACCATCA ACAACCTTGG TATTGGTCGA AGTGTTGATG AGACAATGAG AACCCTCCAG GCATTACAGT ATGTTCAAGA  AAACCCGGAT GAAGTTTGCC CTGCGGGATG GAAGCCCGGG GAGAAATCAA TGAAACCTGA CCCCAAGCTC AGCAAAGAAT ACTTTTCAGC TATCTAGAAG CTAAAACTGA ACAATTGTTT 

Retrieve as FASTA