Entry information : AlyPrx20
Entry ID 7480
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx20
Name AlyPrx20
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx20
start..stop
S start..stop
AhalPrx14 672 0 1..336 1..336
CagraPrx24 655 0 1..336 1..337
CrubPrx116 655 0 1..336 1..337
AtPrx20 653 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16804718..16804942 225 N° 2 16805151..16805342 192 N° 3 16805425..16806018 594  
join(16804718..16804942,16805151..16805342,16805425..16806018)


exon

Literature and cross-references AlyPrx20
DNA ref. Phytozome 12:   scaffold_4 (16804718..16806018)
Protein sequence: AlyPrx20
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (312)
PWM (Da):   %s   37872.34 (35157.8) Transmb domain:   %s   i9-31o
PI (pH):   %s   5.11 (4.98) Peptide Signal:   %s   cut: 25 range:25-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEINQKKLWLSLIVLYAITTSVLGDFGGPLLKDFYKESCPLAGEIVRHNVEVAVLKDPRMAASLLRLQFHDCFVLGCDASVLLDTHEDMLSEKQATPNVNSLRGFEVIDYIKYLLEDACPLTVSCSDILAMAARDSVFLRGGPWWEVLLGRRDSLKASFAGANQFIPAPNSSLDSLIINFKQQGLDIQDLIALSGAHTIGKARCLSFKQRIVQPNIEQTFYVDEFKRHSTFRRVLRSQCKDSSRDNELSPLDLKTPAYFDNHYYINLLEGKGLLISDNVLVSEDHEGEIFRKVWEYAVDQNLFFADFVESMLKMGNINVLTGIEGEIRENCRFVNV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAACCAGAAGAAGCTTTGGCTTTCTTTAATTGTGCTTTATGCAATCACGACATCGGTTTTGGGGGACTTTGGAGGTCCATTACTGAAGGATTTCTACAAAGAGAGTTGCCCA
TTGGCAGGGGAAATCGTGAGGCATAACGTTGAGGTTGCTGTTCTCAAAGATCCTCGTATGGCTGCTTCTCTTCTCCGTCTTCAGTTCCACGATTGCTTCGTCTTG
GTTAGCAAATCATCC
CTCTCTACTCTTTTTATTTCCTCATTTGCGAGTTTTTGCTTCTGTTCTCTCCGAGATCATAAATTTTTCAAGTAGTTTTGAGGCTCTAAATCTAGCATACTTCTTGAATAGTATTTGAAT
TTTGGTGTATGAGAGTGGGATTGTCTTAGTGCGTCGATTTGATGTTCAAATGCGGGATTAATTGTGGGTTTAGGGTTGTGATGCGTCTGTGCTCTTGGACACACATGAAGATATGTTGAG
TGAGAAACAAGCAACTCCTAATGTGAACTCTTTGCGTGGATTTGAAGTAATCGATTACATTAAGTACCTCCTCGAAGATGCTTGTCCTCTAACCGTCTCCTGTTCTGATATTCTCGCCAT
GGCCGCTCGTGACTCTGTCTTCCTG
GTAAATTCCCCTTTTCTCCTTAAATCGAAACCTATGGGGTCAATTTCCTTAAAACACAAATATTGTTTGGTATTATCATCAGAGAGGTGGACCAT
GGTGGGAAGTATTGCTTGGGAGAAGAGACTCATTAAAGGCAAGCTTCGCAGGCGCAAACCAATTCATTCCAGCACCAAACTCCTCCCTCGACAGCCTCATCATCAATTTCAAGCAACAAG
GCCTCGACATTCAAGATCTCATCGCTCTTTCAGGCGCTCATACAATAGGTAAAGCGAGATGCTTGAGCTTCAAGCAACGCATTGTCCAGCCAAACATTGAACAAACGTTCTACGTAGATG
AGTTCAAGAGACACAGCACATTCCGCCGAGTGCTACGGTCACAATGCAAAGATTCAAGCCGCGACAATGAACTGTCTCCACTGGATTTAAAGACACCAGCTTACTTTGATAACCATTACT
ACATCAACCTGTTAGAGGGGAAAGGGTTGTTGATTTCGGATAACGTTCTGGTCTCGGAAGATCATGAAGGAGAGATCTTTCGGAAAGTTTGGGAATATGCAGTTGATCAAAATCTCTTCT
TTGCAGATTTTGTAGAGTCTATGTTGAAAATGGGGAATATTAATGTTCTTACAGGCATTGAAGGTGAAATTAGGGAAAATTGTAGATTTGTCAATGTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCAACCAGAAGAAGCTTTGGCTTTCTTTAATTGTGCTTTATGCAATCACGACATCGGTTTTGGGGGACTTTGGAGGTCCATTACTGAAGGATTTCTACAAAGAGAGTTGCCCA
TTGGCAGGGGAAATCGTGAGGCATAACGTTGAGGTTGCTGTTCTCAAAGATCCTCGTATGGCTGCTTCTCTTCTCCGTCTTCAGTTCCACGATTGCTTCGTCTTG
GGTTGTGATGCGTCT
GTGCTCTTGGACACACATGAAGATATGTTGAGTGAGAAACAAGCAACTCCTAATGTGAACTCTTTGCGTGGATTTGAAGTAATCGATTACATTAAGTACCTCCTCGAAGATGCTTGTCCT
CTAACCGTCTCCTGTTCTGATATTCTCGCCATGGCCGCTCGTGACTCTGTCTTCCTG
AGAGGTGGACCATGGTGGGAAGTATTGCTTGGGAGAAGAGACTCATTAAAGGCAAGCTTCGCA
GGCGCAAACCAATTCATTCCAGCACCAAACTCCTCCCTCGACAGCCTCATCATCAATTTCAAGCAACAAGGCCTCGACATTCAAGATCTCATCGCTCTTTCAGGCGCTCATACAATAGGT
AAAGCGAGATGCTTGAGCTTCAAGCAACGCATTGTCCAGCCAAACATTGAACAAACGTTCTACGTAGATGAGTTCAAGAGACACAGCACATTCCGCCGAGTGCTACGGTCACAATGCAAA
GATTCAAGCCGCGACAATGAACTGTCTCCACTGGATTTAAAGACACCAGCTTACTTTGATAACCATTACTACATCAACCTGTTAGAGGGGAAAGGGTTGTTGATTTCGGATAACGTTCTG
GTCTCGGAAGATCATGAAGGAGAGATCTTTCGGAAAGTTTGGGAATATGCAGTTGATCAAAATCTCTTCTTTGCAGATTTTGTAGAGTCTATGTTGAAAATGGGGAATATTAATGTTCTT
ACAGGCATTGAAGGTGAAATTAGGGAAAATTGTAGATTTGTCAATGTCTAA

Retrieve as FASTA