Entry information : AlyPrx45
Entry ID 7483
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx45
Name AlyPrx45
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx45
start..stop
S start..stop
AhalPrx16 666 0 1..325 1..325
AtPrx45 615 0 1..325 1..325
BrPrx45-1Aa_other 605 0 1..325 1..325
TsPrx45 604 0 1..325 3..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4930243..4930458 216 N° 2 4929897..4930085 189 N° 3 4929390..4929555 166 N° 4 4928891..4929297 407
complement(join(4928891..4929297,4929390..4929555,4929897..4930085,4930243..4930 458))


exon

Literature and cross-references AlyPrx45
DNA ref. Phytozome 12:   scaffold_7 (4930458..4928891)
Protein sequence: AlyPrx45
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (300)
PWM (Da):   %s   35592.95 (32846.5)  
PI (pH):   %s   9.34 (9.57) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKYTAQTIFSIFSLLLLLSSCVSAQLRTGFYQNSCPNVEGIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMIASPSERDHPDDMSLAGDGFDTVVKAKQAVDSNPNCRNKVSCADILALATREVVVLTGGPSYPVELGRRDGRISTQSSVQNQLPQPGFNLNQLNGMFSRHGLSQTDMIALSGAHTIGFAHCGKFTKRIYNFSPSRRIDPTINSGYVIQLKQMCPIGVDVRIAINMDPTSPRTFDNAYFKNLQQGKGLFSSDQILFTDQRSRSTVNTFANSEGAFRQAFITAITKLGRVGVLTGNAGEIRRDCSRAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGTATACTGCCCAAACCATCTTCTCCATATTTTCTCTTCTTCTTCTCCTTTCTTCATGTGTCTCTGCTCAGCTCCGGACAGGTTTCTACCAGAACTCATGTCCGAACGTCGAA
GGCATTGTCCGTAACGCCGTCCGTCAGAAATTCCAGCAGACTTTTGTTACGGCTCCGGCCACTCTCCGCCTCTTCTTCCACGATTGCTTCGTTCGG
GTAGGTTACAATATTTTCTTACAA
TATAAAATCTATTGTTGATCGAAATCTACGCAAAACGTCTAGATTTAGAGTTTAAGATGTTTCTCTTTCTATATATCATTTTCAAACAAAACATTATATTTACATACGTTCTTATGTAAA
TATGAATGTTTAGGGGTGTGATGCGTCAATAATGATAGCATCACCGTCGGAGAGAGACCATCCAGATGACATGTCATTGGCCGGAGATGGATTCGACACGGTGGTGAAGGCGAAGCAAGC
CGTTGATAGCAATCCCAACTGCCGCAACAAAGTCTCATGTGCTGACATTTTGGCTCTCGCCACTCGTGAAGTCGTCGTTTTG
GTATTAATATTTTTATTTATTTATTACAACATAAGTTA
ATATTCCTCTCTTTTTCCTTTAATATTATATAATGTCCGAGGTATTGAAAATTCGTTTTTTTCTACAGTATATATCGTTTTCATTTTTCTTGTGCGAAAAAGCTAATCATATCATTAAAT
ATAAAAAAGCATGTTCTTGTTAGAAAAGTTACACTTTTTATTGGCGGTTTGTAGCCATTTAATACAAGTCCAAGTAACAACTTCACAGGTCATATAGTCCTAATAAAAATGTACTATTGA
TAGATTTTATAATAATAATAATAACAATAATAATCTGATGATTAAAACTAAACAAAATTGCAGACCGGAGGACCGAGCTACCCGGTGGAGCTAGGGAGGAGAGATGGCAGAATCTCCACG
CAGTCCAGCGTTCAAAACCAACTGCCTCAGCCCGGTTTTAACCTAAACCAGCTCAACGGCATGTTTAGCCGTCACGGTCTCTCTCAAACCGATATGATCGCCCTCTCAG
GTACCAAAACC
GAACTTAACCGTTTATATTTTCTACTTTAATCAAATTCCAATTAAGATATAGTATTAATGTTATTGTGTTAAATAATTCAGGAGCACACACTATAGGATTTGCACATTGTGGAAAATTCA
CAAAGAGAATCTACAATTTTAGCCCTAGCCGACGTATCGATCCGACTATTAATAGTGGATACGTGATTCAGCTTAAGCAAATGTGCCCGATCGGAGTCGACGTACGAATTGCAATCAACA
TGGATCCGACCAGTCCACGTACTTTCGATAATGCTTATTTCAAGAATCTCCAACAAGGAAAGGGTTTGTTCTCGTCAGATCAAATCTTGTTTACAGATCAACGATCAAGATCTACAGTTA
ATACATTTGCCAATAGTGAAGGAGCTTTTAGACAAGCTTTTATCACAGCCATCACCAAGTTGGGTCGGGTTGGTGTTTTGACTGGTAATGCTGGTGAGATTCGAAGGGATTGTTCACGTG
CCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGTATACTGCCCAAACCATCTTCTCCATATTTTCTCTTCTTCTTCTCCTTTCTTCATGTGTCTCTGCTCAGCTCCGGACAGGTTTCTACCAGAACTCATGTCCGAACGTCGAA
GGCATTGTCCGTAACGCCGTCCGTCAGAAATTCCAGCAGACTTTTGTTACGGCTCCGGCCACTCTCCGCCTCTTCTTCCACGATTGCTTCGTTCGG
GGGTGTGATGCGTCAATAATGATA
GCATCACCGTCGGAGAGAGACCATCCAGATGACATGTCATTGGCCGGAGATGGATTCGACACGGTGGTGAAGGCGAAGCAAGCCGTTGATAGCAATCCCAACTGCCGCAACAAAGTCTCA
TGTGCTGACATTTTGGCTCTCGCCACTCGTGAAGTCGTCGTTTTG
ACCGGAGGACCGAGCTACCCGGTGGAGCTAGGGAGGAGAGATGGCAGAATCTCCACGCAGTCCAGCGTTCAAAAC
CAACTGCCTCAGCCCGGTTTTAACCTAAACCAGCTCAACGGCATGTTTAGCCGTCACGGTCTCTCTCAAACCGATATGATCGCCCTCTCAG
GAGCACACACTATAGGATTTGCACATTGT
GGAAAATTCACAAAGAGAATCTACAATTTTAGCCCTAGCCGACGTATCGATCCGACTATTAATAGTGGATACGTGATTCAGCTTAAGCAAATGTGCCCGATCGGAGTCGACGTACGAATT
GCAATCAACATGGATCCGACCAGTCCACGTACTTTCGATAATGCTTATTTCAAGAATCTCCAACAAGGAAAGGGTTTGTTCTCGTCAGATCAAATCTTGTTTACAGATCAACGATCAAGA
TCTACAGTTAATACATTTGCCAATAGTGAAGGAGCTTTTAGACAAGCTTTTATCACAGCCATCACCAAGTTGGGTCGGGTTGGTGTTTTGACTGGTAATGCTGGTGAGATTCGAAGGGAT
TGTTCACGTGCCAATTAG

Retrieve as FASTA