Entry information : AlyPrx60
Entry ID 7484
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx60
Name AlyPrx60
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx60
start..stop
S start..stop
BstrPrx69 609 0 1..327 1..327
AtPrx60 593 0 1..330 1..331
AhalPrx04 593 0 1..330 1..331
CagraPrx05 560 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9360533..9360751 219 N° 2 9360876..9361055 180 N° 3 9361145..9361310 166 N° 4 9361461..9361888 428
join(9360533..9360751,9360876..9361055,9361145..9361310,9361461..9361888)


exon

Literature and cross-references AlyPrx60
DNA ref. Phytozome 12:   scaffold_6 (9360533..9361888)
Protein sequence: AlyPrx60
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (304)
PWM (Da):   %s   35823.19 (33102.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.86 (7.68) Peptide Signal:   %s   cut: 27 range:27-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVKISTISVLILSLALLSFGHCCYGQLRIGFYSTKCPNVENIVSKVVGEAFIKGSSIAPAMIRLYFHDCFSNGCDASLLLDGASSEKKASPNLSVRGYELIDDIKSAVEQECDRVVSCADIIALATRDLVTLASGGKTRYEIPTGRLDGKVSLALLVDLPSPRMTVSQTAAKFADRKLSLTDMVLLLGGHTIGVAHCSFVMDRLYNFQNTQQPDPSMDPKLVQELRLKCPKDSSIDGIINLDQNFTSSNTMDVSFYKQINFHRGILHIDQQLAIDGMTSKMVTDIANGNDFLARFGQAMVNLGSVRLISKAKDGEIRKSCRSCNNPSCV

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTGAAGATCTCAACCATATCAGTATTGATCCTTTCCCTTGCTCTACTTAGCTTCGGCCATTGTTGTTATGGCCAGCTTCGAATCGGATTCTACAGTACAAAGTGCCCAAATGTC
GAAAACATTGTATCTAAAGTTGTTGGAGAGGCATTCATCAAGGGTTCGTCCATTGCACCCGCAATGATCCGCCTTTATTTTCACGATTGTTTTAGCAAC
GTAAGTTGGTTAATACTTTTT
TTTTTTTTGGTTAATACTTATTATACTTAAAATTTGCTAGAATGTTTTAATGGGTCTTAAAAGAAATAGGTATTGATCTTTGATGTATTGAAAATGTATGTAGGGATGTGATGCATCGCT
TCTTCTAGACGGTGCGAGCAGTGAGAAAAAGGCGTCGCCAAATCTAAGTGTACGAGGATACGAATTGATAGATGACATTAAATCTGCGGTCGAGCAAGAATGCGATAGGGTCGTTTCTTG
TGCTGATATCATAGCTCTCGCGACTAGAGATCTTGTTACTCTT
GTAAACACATCTCTTATAACTACAACTTCTATTTTATATGTTTCCTACCTAATCGACTGCAAAAAGATAACTTAAAT
TTTTATTTGAAGGCAAGCGGAGGGAAAACACGATATGAGATACCAACAGGACGATTAGACGGCAAAGTCTCTTTGGCTTTGCTCGTGGATTTACCGTCTCCTCGGATGACCGTCTCGCAA
ACTGCTGCGAAATTTGCTGACAGGAAACTAAGCCTTACCGATATGGTTCTACTTCTTG
GTATGGAAAGTAAACATATTAAATTCAAATAATATATTTTTGTTGTATATAATGTTATAACA
CTAGTGAGAATCATTAGACTAAATGTTTCGGTTTTAAATAATAAAAAATTTCATGACATTTTTTTGGGTTTAATTTATAAATTTATAGGTGGACATACGATCGGAGTTGCACATTGTTCG
TTCGTTATGGACCGGCTATATAATTTCCAAAATACGCAACAACCTGATCCATCCATGGATCCTAAATTGGTCCAAGAACTAAGACTCAAATGCCCTAAGGATTCGTCAATTGATGGCATC
ATTAATCTGGATCAAAATTTTACGAGTTCGAATACTATGGATGTATCTTTCTATAAACAGATAAATTTTCACCGCGGAATCCTTCATATCGATCAACAACTTGCCATCGATGGGATGACG
AGTAAGATGGTGACGGATATAGCCAATGGTAACGACTTCTTGGCTAGGTTTGGTCAGGCAATGGTGAATTTGGGATCGGTGAGACTTATTAGTAAGGCCAAAGACGGGGAGATAAGAAAA
TCATGTCGTTCTTGCAACAATCCATCATGCGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTGAAGATCTCAACCATATCAGTATTGATCCTTTCCCTTGCTCTACTTAGCTTCGGCCATTGTTGTTATGGCCAGCTTCGAATCGGATTCTACAGTACAAAGTGCCCAAATGTC
GAAAACATTGTATCTAAAGTTGTTGGAGAGGCATTCATCAAGGGTTCGTCCATTGCACCCGCAATGATCCGCCTTTATTTTCACGATTGTTTTAGCAAC
GGATGTGATGCATCGCTTCTT
CTAGACGGTGCGAGCAGTGAGAAAAAGGCGTCGCCAAATCTAAGTGTACGAGGATACGAATTGATAGATGACATTAAATCTGCGGTCGAGCAAGAATGCGATAGGGTCGTTTCTTGTGCT
GATATCATAGCTCTCGCGACTAGAGATCTTGTTACTCTT
GCAAGCGGAGGGAAAACACGATATGAGATACCAACAGGACGATTAGACGGCAAAGTCTCTTTGGCTTTGCTCGTGGATTTA
CCGTCTCCTCGGATGACCGTCTCGCAAACTGCTGCGAAATTTGCTGACAGGAAACTAAGCCTTACCGATATGGTTCTACTTCTTG
GTGGACATACGATCGGAGTTGCACATTGTTCGTTC
GTTATGGACCGGCTATATAATTTCCAAAATACGCAACAACCTGATCCATCCATGGATCCTAAATTGGTCCAAGAACTAAGACTCAAATGCCCTAAGGATTCGTCAATTGATGGCATCATT
AATCTGGATCAAAATTTTACGAGTTCGAATACTATGGATGTATCTTTCTATAAACAGATAAATTTTCACCGCGGAATCCTTCATATCGATCAACAACTTGCCATCGATGGGATGACGAGT
AAGATGGTGACGGATATAGCCAATGGTAACGACTTCTTGGCTAGGTTTGGTCAGGCAATGGTGAATTTGGGATCGGTGAGACTTATTAGTAAGGCCAAAGACGGGGAGATAAGAAAATCA
TGTCGTTCTTGCAACAATCCATCATGCGTATAA

Retrieve as FASTA