Entry information : AlyPrx44-1
Entry ID 7487
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx44-1
Name AlyPrx44-1
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx44-1
start..stop
S start..stop
AlyPrx44-2 623 0 1..312 1..312
CrubPrx117 590 0 1..312 1..312
CagraPrx21 588 0 1..312 1..312
CrubPrx65 588 0 1..312 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6840043..6840243 201 N° 2 6839206..6839943 738  
complement(join(6839206..6839943,6840043..6840243))


exon

Literature and cross-references AlyPrx44-1
DNA ref. Phytozome 12:   scaffold_7 (6840243..6839206)
Protein sequence: AlyPrx44-1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (292)
PWM (Da):   %s   33850.36 (31680.2)  
PI (pH):   %s   11.14 (11.15) Peptide Signal:   %s   cut: 21 range:21-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAITALFFLFCFVAPSALAQLRQGFYGRSCPRAESIVANVVASRFRRDRSITAAFLRMQFHDCFVRGCDASLLIDPRPGRPSEKSTGPNASVRGYEVIDEAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRYSVPTGRRDGLRSNPGDVNLPGPTIPVSASIQLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFRDRLADPAMDRSLNARLRNTCRAPNDPSVFLDQRTPFTVDNAIYGEIRRQRGILRIDQNLGLAGSTRGIVSSFASSNTLFRQRFAQAMVKMGTIKVLTGRSGEIRRNCRVFNNGR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGCAATCACAGCTTTGTTTTTCCTTTTCTGTTTCGTTGCTCCCTCTGCTTTGGCGCAGCTCCGACAAGGGTTCTACGGCCGCTCATGCCCTCGAGCTGAATCTATCGTTGCTAAT
GTTGTTGCCAGCCGTTTCCGCCGTGACCGTTCCATCACTGCTGCATTTCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GTTCGTAAGCTTCTCCTTGCATGTGTGTATATGTATATC
GTAAACTAGTTATCATCTAGACATAACACTGATCAAGCAATGTTTTTAATGGTTGTGTAGGGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCTGGAAGGCCATCAGAGAAAAGCACT
GGACCAAACGCAAGCGTGAGAGGCTACGAGGTCATTGATGAGGCTAAGAGACAACTAGAGGCTGCATGTCCCCGAACTGTCTCATGCGCAGACATTGTAACTCTAGCCACAAGAGACTCG
GTCGCATTAGCCGGCGGTCCAAGATACTCAGTACCAACAGGAAGACGTGATGGATTAAGGTCAAACCCTGGTGATGTGAACTTACCCGGACCAACAATTCCGGTTAGCGCATCTATCCAA
TTGTTTGCAGCTCAAGGTATGAATACCAACGATATGGTTACACTTATTGGTGGTGGACACAGCGTTGGTGTTGCACATTGCAGTCTCTTCAGGGACAGGCTTGCCGACCCAGCAATGGAC
AGGTCATTGAATGCTAGGTTGAGGAACACATGTCGTGCCCCAAATGACCCATCAGTCTTTTTGGACCAAAGGACTCCATTTACTGTGGATAACGCTATTTATGGAGAGATCCGAAGACAA
AGAGGAATTCTAAGAATTGATCAAAACTTGGGTCTCGCTGGATCAACCCGTGGAATTGTGTCAAGTTTTGCATCGAGCAATACACTCTTCAGACAGAGATTTGCCCAAGCCATGGTGAAA
ATGGGTACCATTAAGGTTCTTACTGGACGCTCTGGAGAGATCAGGAGAAACTGCAGAGTCTTCAACAACGGACGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGCAATCACAGCTTTGTTTTTCCTTTTCTGTTTCGTTGCTCCCTCTGCTTTGGCGCAGCTCCGACAAGGGTTCTACGGCCGCTCATGCCCTCGAGCTGAATCTATCGTTGCTAAT
GTTGTTGCCAGCCGTTTCCGCCGTGACCGTTCCATCACTGCTGCATTTCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCTGGA
AGGCCATCAGAGAAAAGCACTGGACCAAACGCAAGCGTGAGAGGCTACGAGGTCATTGATGAGGCTAAGAGACAACTAGAGGCTGCATGTCCCCGAACTGTCTCATGCGCAGACATTGTA
ACTCTAGCCACAAGAGACTCGGTCGCATTAGCCGGCGGTCCAAGATACTCAGTACCAACAGGAAGACGTGATGGATTAAGGTCAAACCCTGGTGATGTGAACTTACCCGGACCAACAATT
CCGGTTAGCGCATCTATCCAATTGTTTGCAGCTCAAGGTATGAATACCAACGATATGGTTACACTTATTGGTGGTGGACACAGCGTTGGTGTTGCACATTGCAGTCTCTTCAGGGACAGG
CTTGCCGACCCAGCAATGGACAGGTCATTGAATGCTAGGTTGAGGAACACATGTCGTGCCCCAAATGACCCATCAGTCTTTTTGGACCAAAGGACTCCATTTACTGTGGATAACGCTATT
TATGGAGAGATCCGAAGACAAAGAGGAATTCTAAGAATTGATCAAAACTTGGGTCTCGCTGGATCAACCCGTGGAATTGTGTCAAGTTTTGCATCGAGCAATACACTCTTCAGACAGAGA
TTTGCCCAAGCCATGGTGAAAATGGGTACCATTAAGGTTCTTACTGGACGCTCTGGAGAGATCAGGAGAAACTGCAGAGTCTTCAACAACGGACGTTGA

Retrieve as FASTA