Entry information : AlyPrx55
Entry ID 7489
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx55
Name AlyPrx55
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx55
start..stop
S start..stop
AtPrx55 615 0 1..330 1..330
BstrPrx41 600 0 1..330 7..336
CrubPrx70 551 0 1..330 1..335
CagraPrx38 540 0 1..330 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5702070..5702300 231 N° 2 5701783..5701974 192 N° 3 5701136..5701705 570  
complement(join(5701136..5701705,5701783..5701974,5702070..5702300))


exon

Literature and cross-references AlyPrx55
DNA ref. Phytozome 11:   scaffold_6 (5702300..5701136)
Protein sequence: AlyPrx55
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (300)
PWM (Da):   %s   35667.43 (32246.9)  
PI (pH):   %s   4.53 (4.54) Peptide Signal:   %s   cut: 31 range:31-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDTRRDDATKPMTMWFSGMLLFSMVAESNAQLSENYYASTCPNVELIVKQAVTTKFQQTPTTAPATLRMFFHDCFVEGCDASVFIASDNEDAEKDAPDNKSLPGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVIVGGPEFKVELGRRDGLVSQASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSGAHTIGSSHCNRFANRLHNFSTFLPLDPTIDPAYAQQLTKDCSNPDPDFVVPLDPTTTDTFDNSYFQNLVARRGLLTSDQALFNDLSSQSTVMRFANNAEEFYGAFSSAMRNLGRVGVKVGSEGEIRRDCSAFN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, introns 1 and 2)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATACTCGTAGGGATGATGCAACAAAACCCATGACGATGTGGTTTTCGGGGATGCTGTTGTTTTCCATGGTGGCCGAGTCAAATGCCCAACTGTCAGAGAATTACTACGCCTCGACT
TGTCCTAACGTCGAGCTCATCGTTAAGCAGGCGGTTACTACAAAATTCCAACAAACTCCTACGACGGCTCCGGCAACGTTACGGATGTTCTTTCACGACTGCTTCGTCGAG
GTATGTGCA
AACAACGGAGGTTTGTGTAGATTTTTTTTACGTTTATGGAGTCCTTTTGGTATTTGTGAATAATCTTGGTTGGTTTTTTTTTATAGGGATGTGATGCGTCTGTGTTTATAGCATCTGACA
ATGAAGACGCAGAGAAAGACGCGCCGGACAATAAATCTCTCCCCGGAGACGGATTTGACACTGTGATTAAAGCTAAAACCGCTGTAGAATCTCAATGTCCCGGCGTTGTGTCATGTGCCG
ATATTCTAGCTCTCGCCGCCAGAGACGTTGTCGTCATC
GTAAGTCCACGCATCGCGTTACTGACGTTTCATTTGATTTCCCCAAGTAAAAACCATTTACTCTGTGATGATAACAGGTTGG
AGGGCCAGAGTTTAAGGTGGAGCTAGGTAGACGAGACGGGCTCGTGTCGCAAGCATCTAGAGTGACCGGGAAGTTACCTGAACCAGGGCTTGACGTGAGAGGTCTAGTCCAGATCTTTGC
TAGTAACGGGCTTTCATTGACCGACATGATTGCTCTCTCAGGCGCACATACCATTGGATCCTCTCACTGCAACCGTTTCGCCAACCGTCTCCACAACTTCTCGACGTTCCTGCCCTTGGA
CCCTACGATCGACCCGGCCTACGCACAGCAGCTGACAAAAGACTGCTCTAACCCCGATCCTGACTTCGTCGTGCCCCTGGACCCAACCACCACAGATACCTTCGACAATAGCTATTTCCA
GAACCTAGTGGCTCGAAGAGGCCTTCTCACCTCCGATCAAGCTCTGTTTAACGATCTCTCGTCTCAGTCCACGGTGATGAGGTTTGCTAACAACGCCGAAGAATTCTACGGTGCTTTTAG
CTCTGCTATGAGGAATCTTGGTCGCGTTGGTGTTAAGGTTGGGAGCGAAGGAGAGATTCGAAGGGACTGCTCTGCTTTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATACTCGTAGGGATGATGCAACAAAACCCATGACGATGTGGTTTTCGGGGATGCTGTTGTTTTCCATGGTGGCCGAGTCAAATGCCCAACTGTCAGAGAATTACTACGCCTCGACT
TGTCCTAACGTCGAGCTCATCGTTAAGCAGGCGGTTACTACAAAATTCCAACAAACTCCTACGACGGCTCCGGCAACGTTACGGATGTTCTTTCACGACTGCTTCGTCGAG
GGATGTGAT
GCGTCTGTGTTTATAGCATCTGACAATGAAGACGCAGAGAAAGACGCGCCGGACAATAAATCTCTCCCCGGAGACGGATTTGACACTGTGATTAAAGCTAAAACCGCTGTAGAATCTCAA
TGTCCCGGCGTTGTGTCATGTGCCGATATTCTAGCTCTCGCCGCCAGAGACGTTGTCGTCATC
GTTGGAGGGCCAGAGTTTAAGGTGGAGCTAGGTAGACGAGACGGGCTCGTGTCGCAA
GCATCTAGAGTGACCGGGAAGTTACCTGAACCAGGGCTTGACGTGAGAGGTCTAGTCCAGATCTTTGCTAGTAACGGGCTTTCATTGACCGACATGATTGCTCTCTCAGGCGCACATACC
ATTGGATCCTCTCACTGCAACCGTTTCGCCAACCGTCTCCACAACTTCTCGACGTTCCTGCCCTTGGACCCTACGATCGACCCGGCCTACGCACAGCAGCTGACAAAAGACTGCTCTAAC
CCCGATCCTGACTTCGTCGTGCCCCTGGACCCAACCACCACAGATACCTTCGACAATAGCTATTTCCAGAACCTAGTGGCTCGAAGAGGCCTTCTCACCTCCGATCAAGCTCTGTTTAAC
GATCTCTCGTCTCAGTCCACGGTGATGAGGTTTGCTAACAACGCCGAAGAATTCTACGGTGCTTTTAGCTCTGCTATGAGGAATCTTGGTCGCGTTGGTGTTAAGGTTGGGAGCGAAGGA
GAGATTCGAAGGGACTGCTCTGCTTTTAACTAG

Retrieve as FASTA