Entry information : AlyPrx30
Entry ID 7491
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx30
Name AlyPrx30
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx30
start..stop
S start..stop
AtPrx30 639 0 1..329 1..329
CagraPrx41 629 0 4..329 1..326
BstrPrx02 625 0 1..329 1..329
CrubPrx66 620 0 4..329 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9661240..9661461 222 N° 2 9661692..9661880 189 N° 3 9661962..9662124 163 N° 4 9662244..9662659 416
join(9661240..9661461,9661692..9661880,9661962..9662124,9662244..9662659)


exon

Literature and cross-references AlyPrx30
DNA ref. Phytozome 12:   scaffold_3 (9661240..9662659)
Protein sequence: AlyPrx30
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35536.2 (32806.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.76 (9.77) Peptide Signal:   %s   cut: 28 range:28-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTMKQLNIAVAVAVTVLIGMLGSSEAQLQMNFYAKSCPNAEKIISDHIQNHIPNGPSLAAPLIRMHFHDCFVRGCDGSVLINSTSGNAERDAPPNLTLRGFGFVERIKALLEKVCPKTVSCADIIALTARDAVVATGGPSWNVPTGRRDGRISNVTEATNNIPPPTSNFTTLQRLFKNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSEYAANLKANKCKSLNDNTTILEMDPGSSRTFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINNLVNGPEQKFYEAFAKSMEKMGRVKVKTGSAGVIRTRCSVAGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACGATGAAGCAATTGAATATTGCGGTTGCGGTTGCAGTGACGGTCCTAATTGGAATGTTGGGATCATCAGAGGCTCAACTTCAAATGAATTTCTATGCGAAGAGCTGTCCAAAC
GCAGAGAAAATCATTTCTGACCATATTCAAAATCATATCCCTAATGGTCCTTCCCTTGCAGCTCCTCTCATCAGGATGCACTTCCATGATTGCTTCGTTAGG
GTATTTATCTAATCTCTA
ATCCACATATTTATATATACTTACTTGCAAGTGTTTAGATATGTTCGTCTTATATGTGCATATATAAAAATTAATATTCATACATTAATATCATTTAGTTCAATGTTTCACTTCATTTGA
ACTATTTAATGAAAATGGTAAATTTGAGCTAGAGCAGAATATTTGAGATTTATTGCATTTTTTTCAATATCGACAATGGTTTTTTAAAAAAGGGATGTGATGGATCGGTGTTGATAAATT
CAACATCTGGGAACGCAGAGAGAGATGCACCACCGAATCTAACACTTAGAGGATTCGGTTTCGTTGAAAGGATTAAGGCTCTTCTTGAAAAAGTGTGTCCTAAGACTGTTTCTTGCGCTG
ATATCATCGCTTTGACCGCTAGAGACGCAGTTGTTGCCACC
GTAAGTGTTACATATTATAAACTCGCAACTCAATTCGTAGATTAAGCAAATTAATTGAAATTATTATCTAAAATTTGAC
AGGGAGGTCCTTCATGGAATGTTCCAACGGGTAGAAGAGACGGTAGGATCTCAAATGTGACGGAGGCTACGAACAACATTCCACCGCCAACGAGTAATTTCACGACTTTACAGCGACTTT
TCAAAAACCAAGGCCTTAATCTCAAAGATCTTGTTCTGCTCTCCG
GTAAGTTCATTAACCGGTTGATAGCAGTTTAGTCACGGTTGTCCTTTTTGAGACATTATATCGATACAACTTATA
TCCAACTTAAATTTTACTATCCGTTACTCGTACCCGTTGTTTAGGGGCTCACACGATTGGTGTCTCGCATTGTTCTTCCATGAATACTCGTCTCTACAACTTCTCGACTACAGTCAAACA
AGATCCATCTCTCGATAGCGAGTACGCAGCAAATCTAAAGGCTAACAAATGTAAGAGCCTTAACGACAACACCACTATCCTCGAGATGGATCCCGGTAGTAGCAGAACCTTCGATCTCAG
TTATTATAGGCTTGTCCTGAAGAGAAGAGGCTTGTTTCAGTCTGATTCTGCATTAACAACGAACTCAGCGACGTTGAAGGTGATCAACAATTTGGTCAACGGTCCTGAACAAAAGTTTTA
CGAAGCTTTTGCTAAGTCAATGGAGAAGATGGGGAGAGTCAAAGTGAAGACGGGCTCAGCCGGTGTGATCAGGACACGGTGTTCTGTCGCCGGAAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGACGATGAAGCAATTGAATATTGCGGTTGCGGTTGCAGTGACGGTCCTAATTGGAATGTTGGGATCATCAGAGGCTCAACTTCAAATGAATTTCTATGCGAAGAGCTGTCCAAAC
GCAGAGAAAATCATTTCTGACCATATTCAAAATCATATCCCTAATGGTCCTTCCCTTGCAGCTCCTCTCATCAGGATGCACTTCCATGATTGCTTCGTTAGG
GGATGTGATGGATCGGTG
TTGATAAATTCAACATCTGGGAACGCAGAGAGAGATGCACCACCGAATCTAACACTTAGAGGATTCGGTTTCGTTGAAAGGATTAAGGCTCTTCTTGAAAAAGTGTGTCCTAAGACTGTT
TCTTGCGCTGATATCATCGCTTTGACCGCTAGAGACGCAGTTGTTGCCACC
GGAGGTCCTTCATGGAATGTTCCAACGGGTAGAAGAGACGGTAGGATCTCAAATGTGACGGAGGCTACG
AACAACATTCCACCGCCAACGAGTAATTTCACGACTTTACAGCGACTTTTCAAAAACCAAGGCCTTAATCTCAAAGATCTTGTTCTGCTCTCCG
GGGCTCACACGATTGGTGTCTCGCAT
TGTTCTTCCATGAATACTCGTCTCTACAACTTCTCGACTACAGTCAAACAAGATCCATCTCTCGATAGCGAGTACGCAGCAAATCTAAAGGCTAACAAATGTAAGAGCCTTAACGACAAC
ACCACTATCCTCGAGATGGATCCCGGTAGTAGCAGAACCTTCGATCTCAGTTATTATAGGCTTGTCCTGAAGAGAAGAGGCTTGTTTCAGTCTGATTCTGCATTAACAACGAACTCAGCG
ACGTTGAAGGTGATCAACAATTTGGTCAACGGTCCTGAACAAAAGTTTTACGAAGCTTTTGCTAAGTCAATGGAGAAGATGGGGAGAGTCAAAGTGAAGACGGGCTCAGCCGGTGTGATC
AGGACACGGTGTTCTGTCGCCGGAAGTTAG

Retrieve as FASTA