Entry information : AlyPrx01
Entry ID 7494
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-27 (Christophe Dunand)
Peroxidase information: AlyPrx01
Name AlyPrx01
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx01
start..stop
S start..stop
AlyPrx02 657 0 1..321 1..321
AhalPrx55 529 0 1..262 1..262
AtPrx02 515 0 1..321 1..325
AtPrx01 515 0 1..321 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1821175..1821390 216 N° 2 1821472..1821657 186 N° 3 1821731..1821896 166 N° 4 1821979..1822376 398
join(1821175..1821390,1821472..1821657,1821731..1821896,1821979..1822376)


exon

Literature and cross-references AlyPrx01
DNA ref. Phytozome 12:   scaffold_1 (1821175..1822376)
Protein sequence: AlyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321
PWM (Da):   %s   35147.59 Transmb domain:   %s   i5-22o
PI (pH):   %s   9.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKNLLALVVLLSVLGVSVAYPKLIPTLDYYQSKCPDAERIVRRVTEQYVSRKPSLAASLLRMHFHDCFVRGCDGSVLLKTPKNDAERNAIPNLTLRGFEVVDAAKTALEKKCPNLVSCADVLALVARDAVAVIKGPWWPVPLGRRDGRISKLTDALQNLPSPFADIKTLKKNFADKGLNAKDLVVLSGGHTIGISSCALVNTRIYNFTGKGDFDPSMNPSYVRALKKKCSPTDFKSVLEMDPGSAKKFDPHYFTAVAQKKGLFISDSTLLDDLETKLYVQTANEVTFNKDFSDSMVKLGKVQILTGKNGEIRKRCAFPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGAACCTTCTGGCCCTTGTGGTTCTTCTTAGCGTCCTTGGAGTTTCTGTTGCCTATCCAAAGTTGATCCCTACCCTCGACTACTACCAGTCTAAGTGTCCCGACGCAGAG
CGCATTGTTCGTCGTGTCACAGAACAATATGTTTCTCGGAAGCCAAGCCTTGCCGCTTCGCTTCTAAGGATGCATTTTCATGATTGTTTCGTCAGA
GTAAGCTTGCTTCACTTCTCCGAG
ACTTTAATAATGGATATGAGAAAAAATAGCCCTAACTCTTTTTAATGATTCATGAAGGGATGTGATGGTTCCGTTCTTCTGAAAACTCCAAAGAATGATGCGGAAAGAAACGCTATCCCC
AACCTGACCCTGAGAGGCTTTGAAGTGGTGGATGCGGCCAAGACAGCGCTCGAGAAGAAGTGTCCCAATCTCGTTTCTTGCGCTGATGTTCTTGCCTTGGTCGCCAGAGATGCCGTCGCA
GTG
GTAACATTTTCGCATTGGACTCATTCCAAAATTAAAGCCTACTATGTATATATAACTTGTTGTCTCTTAACAGATCAAGGGACCATGGTGGCCGGTTCCATTGGGCCGCAGGGATGG
ACGCATCTCAAAATTGACAGATGCATTGCAAAATTTACCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCGGACAAGGGTCTTAACGCTAAAGACCTTGTCGTTCTCTC
AG
GTATTATTTTCTTATGTGCGTGCAATCTCAAAAGTTATCAATTTGAGAGTTGAAAGCTGAATAAAAATGGTTTCTTGATTAGGGGGTCACACCATTGGAATCTCCAGTTGCGCTCTCG
TCAACACACGTATCTACAACTTCACAGGAAAGGGCGATTTTGACCCATCCATGAACCCTAGCTACGTGAGGGCGTTGAAGAAGAAGTGCAGCCCTACAGATTTCAAATCCGTACTGGAAA
TGGACCCAGGCAGTGCCAAGAAATTCGACCCTCACTACTTCACTGCCGTGGCTCAGAAGAAAGGTCTCTTCATATCTGACTCTACCCTTCTCGATGACCTTGAGACCAAACTCTACGTCC
AGACCGCTAACGAGGTTACTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTAAAGTCCAAATTCTTACCGGGAAAAATGGTGAGATCAGGAAGAGATGCGCCTTCCCTAACT
GA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGAACCTTCTGGCCCTTGTGGTTCTTCTTAGCGTCCTTGGAGTTTCTGTTGCCTATCCAAAGTTGATCCCTACCCTCGACTACTACCAGTCTAAGTGTCCCGACGCAGAG
CGCATTGTTCGTCGTGTCACAGAACAATATGTTTCTCGGAAGCCAAGCCTTGCCGCTTCGCTTCTAAGGATGCATTTTCATGATTGTTTCGTCAGA
GGATGTGATGGTTCCGTTCTTCTG
AAAACTCCAAAGAATGATGCGGAAAGAAACGCTATCCCCAACCTGACCCTGAGAGGCTTTGAAGTGGTGGATGCGGCCAAGACAGCGCTCGAGAAGAAGTGTCCCAATCTCGTTTCTTGC
GCTGATGTTCTTGCCTTGGTCGCCAGAGATGCCGTCGCAGTG
ATCAAGGGACCATGGTGGCCGGTTCCATTGGGCCGCAGGGATGGACGCATCTCAAAATTGACAGATGCATTGCAAAAT
TTACCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCGGACAAGGGTCTTAACGCTAAAGACCTTGTCGTTCTCTCAG
GGGGTCACACCATTGGAATCTCCAGTTGCGCT
CTCGTCAACACACGTATCTACAACTTCACAGGAAAGGGCGATTTTGACCCATCCATGAACCCTAGCTACGTGAGGGCGTTGAAGAAGAAGTGCAGCCCTACAGATTTCAAATCCGTACTG
GAAATGGACCCAGGCAGTGCCAAGAAATTCGACCCTCACTACTTCACTGCCGTGGCTCAGAAGAAAGGTCTCTTCATATCTGACTCTACCCTTCTCGATGACCTTGAGACCAAACTCTAC
GTCCAGACCGCTAACGAGGTTACTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTAAAGTCCAAATTCTTACCGGGAAAAATGGTGAGATCAGGAAGAGATGCGCCTTCCCT
AACTGA

Retrieve as FASTA