Entry information : AlyPrx02
Entry ID 7495
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-10 (Christophe Dunand)
Peroxidase information: AlyPrx02
Name AlyPrx02
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx02
start..stop
S start..stop
AlyPrx01 657 0 1..321 1..321
AhalPrx55 529 0 1..262 1..262
AtPrx02 515 0 1..321 1..325
AtPrx01 515 0 1..321 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1828336..1828551 216 N° 2 1828069..1828254 186 N° 3 1827830..1827995 166 N° 4 1827350..1827747 398
complement(join(1827350..1827747,1827830..1827995,1828069..1828254,1828336..1828 551))


exon

Literature and cross-references AlyPrx02
DNA ref. Phytozome 11:   scaffold_1 (1828551..1827353)
Protein sequence: AlyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (300)
PWM (Da):   %s   35147.59 (33069.3) Transmb domain:   %s   i5-22o
PI (pH):   %s   9.88 (9.80) Peptide Signal:   %s   cut: 22 range:22-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKNLLALVVLLSVLGVSVAYPKLIPTLDYYQSKCPDAERIVRRVTEQYVSRKPSLAASLLRMHFHDCFVRGCDGSVLLKTPKNDAERNAIPNLTLRGFEVVDAAKTALEKKCPNLVSCADVLALVARDAVAVIKGPWWPVPLGRRDGRISKLTDALQNLPSPFADIKTLKKNFADKGLNAKDLVVLSGGHTIGISSCALVNTRIYNFTGKGDFDPSMNPSYVRALKKKCSPTDFKSVLEMDPGSAKKFDPHYFTAVAQKKGLFISDSTLLDDLETKLYVQTANEVTFNKDFSDSMVKLGKVQILTGKNGEIRKRCAFPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGAACCTTCTGGCCCTTGTGGTTCTTCTTAGCGTCCTTGGAGTTTCTGTTGCCTATCCAAAGTTGATCCCTACCCTCGACTACTACCAGTCTAAGTGTCCCGACGCAGAG
CGCATTGTTCGTCGTGTCACAGAACAATATGTTTCTCGGAAGCCAAGCCTTGCCGCTTCGCTTCTAAGGATGCATTTTCATGATTGTTTCGTCAGA
GTAAGCTTGCTTCACTTCTCCGAG
ACTTTAATAATGGATATGAGAAAAAATAGCCCTAACTCTTTTTAATGATTCATGAAGGGATGTGATGGTTCCGTTCTTCTGAAAACTCCAAAGAATGATGCGGAAAGAAACGCTATCCCC
AACCTGACCCTGAGAGGCTTTGAAGTGGTGGATGCGGCCAAGACAGCGCTCGAGAAGAAGTGTCCCAATCTCGTTTCTTGCGCTGATGTTCTTGCCTTGGTCGCCAGAGATGCCGTCGCA
GTG
GTAACATTTTCGCATTGGACTCATTCCAAAATTAAAGCCTACTATGTATATATAACTTGTTGTCTCTTAACAGATCAAGGGACCATGGTGGCCGGTTCCATTGGGCCGCAGGGATGG
ACGCATCTCAAAATTGACAGATGCATTGCAAAATTTACCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCGGACAAGGGTCTTAACGCTAAAGACCTTGTCGTTCTCTC
AG
GTATTATTTTCTTATGTGCGTGCAATCTCAAAAGTTATCAATTTGAGAGTTGAAAGCTGAATAAAAATGGTTTCTTGATTAGGGGGTCACACCATTGGAATCTCCAGTTGCGCTCTCG
TCAACACACGTATCTACAACTTCACAGGAAAGGGCGATTTTGACCCATCCATGAACCCTAGCTACGTGAGGGCGTTGAAGAAGAAGTGCAGCCCTACAGATTTCAAATCCGTACTGGAAA
TGGACCCAGGCAGTGCCAAGAAATTCGACCCTCACTACTTCACTGCCGTGGCTCAGAAGAAAGGTCTCTTCATATCTGACTCTACCCTTCTCGATGACCTTGAGACCAAACTCTACGTCC
AGACCGCTAACGAGGTTACTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTAAAGTCCAAATTCTTACCGGGAAAAATGGTGAGATCAGGAAGAGATGCGCCTTCCCTAACT
GA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGAACCTTCTGGCCCTTGTGGTTCTTCTTAGCGTCCTTGGAGTTTCTGTTGCCTATCCAAAGTTGATCCCTACCCTCGACTACTACCAGTCTAAGTGTCCCGACGCAGAG
CGCATTGTTCGTCGTGTCACAGAACAATATGTTTCTCGGAAGCCAAGCCTTGCCGCTTCGCTTCTAAGGATGCATTTTCATGATTGTTTCGTCAGA
GGATGTGATGGTTCCGTTCTTCTG
AAAACTCCAAAGAATGATGCGGAAAGAAACGCTATCCCCAACCTGACCCTGAGAGGCTTTGAAGTGGTGGATGCGGCCAAGACAGCGCTCGAGAAGAAGTGTCCCAATCTCGTTTCTTGC
GCTGATGTTCTTGCCTTGGTCGCCAGAGATGCCGTCGCAGTG
ATCAAGGGACCATGGTGGCCGGTTCCATTGGGCCGCAGGGATGGACGCATCTCAAAATTGACAGATGCATTGCAAAAT
TTACCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCGGACAAGGGTCTTAACGCTAAAGACCTTGTCGTTCTCTCAG
GGGGTCACACCATTGGAATCTCCAGTTGCGCT
CTCGTCAACACACGTATCTACAACTTCACAGGAAAGGGCGATTTTGACCCATCCATGAACCCTAGCTACGTGAGGGCGTTGAAGAAGAAGTGCAGCCCTACAGATTTCAAATCCGTACTG
GAAATGGACCCAGGCAGTGCCAAGAAATTCGACCCTCACTACTTCACTGCCGTGGCTCAGAAGAAAGGTCTCTTCATATCTGACTCTACCCTTCTCGATGACCTTGAGACCAAACTCTAC
GTCCAGACCGCTAACGAGGTTACTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTAAAGTCCAAATTCTTACCGGGAAAAATGGTGAGATCAGGAAGAGATGCGCCTTCCCT
AACTGA

Retrieve as FASTA