Entry information : AlyPrx59
Entry ID 7499
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx59
Name AlyPrx59
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx59
start..stop
S start..stop
AhalPrx07 657 0 1..328 1..328
AtPrx59 630 0 1..328 1..328
BstrPrx86 625 0 1..328 1..328
TsPrx59 624 0 1..328 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8408679..8408903 225 N° 2 8408354..8408536 183 N° 3 8407774..8407936 163 N° 4 8407274..8407689 416
complement(join(8407274..8407689,8407774..8407936,8408354..8408536,8408679..8408 903))


exon

Literature and cross-references AlyPrx59
DNA ref. Phytozome 12:   scaffold_6 (8408903..8407274)
Protein sequence: AlyPrx59
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35122.92 (32148.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.85 (6.73) Peptide Signal:   %s   cut: 29 range:29-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTPTKVMGGHVLLTVFTLCMLCSGVRAQLSFDIYAKSCPNLVQIVRRQVIIALKAEIRMAASLIRLHFHDCFVNGCDASVLLDGADSEKLAIPNINSARGFEVIDTIKDAVENACPGVVSCADILTLAARDSVFLSGGPQWRVALGRKDGLVANQNSANNLPSPFEPLDAIIAKFVAVNLNITDVVALSGAHTFGQAKCAVFSNRLFNFTGAGTPDATLETSLLSNLQTVCPLGGNSNTTAPLDRNSTDAFDNNYFKNLLEGKGLLSSDQILFSSDLAVNTTKRLVEAYSRSQNLFFRDFTCSMIRMGNIANGASGEVRKNCRVINN

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 6, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACACCAACCAAAGTGATGGGAGGACATGTCTTGCTTACTGTATTCACTTTGTGTATGCTTTGTTCAGGGGTTAGGGCACAGCTAAGCTTTGACATTTATGCTAAATCGTGCCCC
AATCTTGTGCAAATTGTCCGTAGACAAGTTATAATTGCCCTGAAGGCCGAGATACGGATGGCTGCTTCCCTCATTCGTCTTCATTTCCACGACTGCTTTGTTAAT
GTATGTATTGTTATC
TCTACGTACTTTCTTCTAAATATATATTTTCTATTAAATAATTTTATAGGTTATAGGATATTGTTACATATTAATTTGTTCCAAACACTTCTCATCAGTAACCTAAAACGTAACTTGAAC
TTTTCAGGGGTGTGATGCGTCTGTATTGTTGGATGGAGCTGACAGCGAGAAACTCGCGATCCCAAACATTAATTCTGCGAGAGGGTTTGAAGTAATTGATACAATCAAAGACGCTGTGGA
AAACGCATGTCCTGGGGTTGTTTCTTGTGCTGATATCCTCACTTTGGCCGCTCGTGACTCGGTTTTCTTG
GTAAGCCTTTCTGTCCCCATTTAACAACCATCAAAACCTTAATACATATA
TATTTTCAGGCAAATTCTCGATTAGATTTTACTAATTTCATATAAAAACTATTTCTAATATGACTTAGGTGTTGATTAGTTATATATAGTAACAAACAAAATGATTACGTTTTTACAAAT
GATTATCTTTTATTTGGTTGATATATATATATATATATATATATATATATATATATATATTGTCATAATGTGGTTGAAATATTTTTCAATGATTATAAACTCTATTATAAAAATATTTGT
GATTGTATATTTGTACGTAATTATATTTCTTCGGTCGTCTATGACTTACACATGCAGACTCTCGGGTTTATAAACCTGGATTATATCTATTCGTTTTTATATCGCCTATAACGGTTTCAA
TTTGTAGAGCGGAGGGCCTCAGTGGAGAGTGGCATTAGGAAGAAAAGATGGATTGGTGGCAAATCAGAACAGTGCAAACAATCTCCCATCTCCTTTTGAACCTTTAGACGCTATTATCGC
CAAATTTGTAGCCGTAAACCTTAACATCACCGACGTCGTAGCTTTATCAG
GTTTAACTAGTTTCTTCAAACCTTAGTTGGTATTCTTTTCTTCTAACTACTTATCACTTATGTATGACCT
TTTTCATTACAAAGGAGCTCACACCTTTGGACAAGCGAAGTGTGCTGTCTTCAGCAACCGTCTGTTCAACTTTACCGGTGCGGGAACTCCTGACGCAACACTTGAGACATCACTGTTGTC
TAATCTGCAAACAGTTTGTCCCCTTGGAGGAAATAGTAACACAACAGCGCCCCTTGACAGGAACTCTACGGACGCCTTTGACAACAATTATTTCAAGAACCTACTCGAAGGGAAAGGTCT
TTTGAGCTCTGATCAGATTCTGTTCTCGAGTGATTTAGCTGTGAACACAACAAAGAGACTAGTGGAGGCTTATAGTCGGAGCCAGAACTTGTTTTTCAGGGACTTCACATGTTCGATGAT
CAGAATGGGAAACATTGCAAATGGAGCTAGTGGGGAGGTTAGGAAGAACTGCAGGGTTATCAATAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACACCAACCAAAGTGATGGGAGGACATGTCTTGCTTACTGTATTCACTTTGTGTATGCTTTGTTCAGGGGTTAGGGCACAGCTAAGCTTTGACATTTATGCTAAATCGTGCCCC
AATCTTGTGCAAATTGTCCGTAGACAAGTTATAATTGCCCTGAAGGCCGAGATACGGATGGCTGCTTCCCTCATTCGTCTTCATTTCCACGACTGCTTTGTTAAT
GGGTGTGATGCGTCT
GTATTGTTGGATGGAGCTGACAGCGAGAAACTCGCGATCCCAAACATTAATTCTGCGAGAGGGTTTGAAGTAATTGATACAATCAAAGACGCTGTGGAAAACGCATGTCCTGGGGTTGTT
TCTTGTGCTGATATCCTCACTTTGGCCGCTCGTGACTCGGTTTTCTTG
AGCGGAGGGCCTCAGTGGAGAGTGGCATTAGGAAGAAAAGATGGATTGGTGGCAAATCAGAACAGTGCAAAC
AATCTCCCATCTCCTTTTGAACCTTTAGACGCTATTATCGCCAAATTTGTAGCCGTAAACCTTAACATCACCGACGTCGTAGCTTTATCAG
GAGCTCACACCTTTGGACAAGCGAAGTGT
GCTGTCTTCAGCAACCGTCTGTTCAACTTTACCGGTGCGGGAACTCCTGACGCAACACTTGAGACATCACTGTTGTCTAATCTGCAAACAGTTTGTCCCCTTGGAGGAAATAGTAACACA
ACAGCGCCCCTTGACAGGAACTCTACGGACGCCTTTGACAACAATTATTTCAAGAACCTACTCGAAGGGAAAGGTCTTTTGAGCTCTGATCAGATTCTGTTCTCGAGTGATTTAGCTGTG
AACACAACAAAGAGACTAGTGGAGGCTTATAGTCGGAGCCAGAACTTGTTTTTCAGGGACTTCACATGTTCGATGATCAGAATGGGAAACATTGCAAATGGAGCTAGTGGGGAGGTTAGG
AAGAACTGCAGGGTTATCAATAATTAG

Retrieve as FASTA