Entry information : AlyPrx11
Entry ID 7502
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx11
Name AlyPrx11
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx11
start..stop
S start..stop
AtPrx11 676 0 1..335 2..336
TsPrx11 654 0 1..335 1..335
BstrPrx23 653 0 1..335 1..335
BrPrx11-1Ab_other 650 0 1..335 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13428318..13428539 222 N° 2 13427921..13428112 192 N° 3 13427652..13427817 166 N° 4 13427142..13427569 428
complement(join(13427142..13427569,13427652..13427817,13427921..13428112,1342831 8..13428539))


exon

Literature and cross-references AlyPrx11
DNA ref. Phytozome 11:   scaffold_2 (13428539..13427142)
Protein sequence: AlyPrx11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (316)
PWM (Da):   %s   36972.63 (34731.4) Transmb domain:   %s   i3-22o
PI (pH):   %s   4.86 (4.77) Peptide Signal:   %s   cut: 20 range:20-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLLLVFFMVLAIFIPCFSFDIPGKDLPLILDYYKSTCPTVFDVIKKEMECIVKEDPRNAAIIIRLHFHDCFVQGCDGSVLLDETATLQGEKKASPNINSLKGYNIVDRIKNIIESECPGVVSCADLLTIGARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIIAKFYSQGLSVEDMVALIGAHTIGKAQCRNFRSRIYGDFQVTSALNPVSETYLASLREICPASSGEGDSNVTAMDNVTPNLFDNSIYHTLLRGEGLLNSDQEMYTSLFGIQTRRIVSKYAEDPVAFFEQFSKSMVKMGNILNSESFADGEVRRNCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACTCCTCCTTGTGTTCTTTATGGTTCTCGCCATCTTTATCCCCTGCTTTTCCTTTGATATACCGGGAAAGGATCTTCCTTTAATCCTAGATTATTACAAGTCTACTTGCCCAACC
GTATTTGACGTCATCAAGAAAGAAATGGAATGCATTGTGAAGGAAGATCCTCGAAATGCAGCCATAATTATTCGTTTACACTTCCACGATTGCTTTGTCCAA
GTAAGTACTCATCCACAC
CTTTCTTAAAACACACGAAATCATCCTGCCAGAGAAAAATTCATATCATGTCAAACATTTACTGCTATCAAATACTTTCTCAAACGACATATCGTGTTAGATTTTGGATGAAATCGAGAC
ATAATTTAGCTGAAAGGGGGTTGCTTTATGGTATGGAGGTTTAAATACTTATAAAATGGTATTGCAGGGATGCGATGGATCGGTGTTGCTAGACGAAACAGCGACACTACAGGGAGAGAA
AAAAGCTTCTCCCAACATAAACTCATTGAAAGGATACAATATTGTAGACAGAATCAAGAACATAATCGAATCTGAATGCCCTGGAGTTGTTTCATGCGCTGATCTCCTCACAATTGGTGC
TAGAGATGCTACAATCCTG
GTAAGTAAACACAAACGAAACATATCTCTCAAAATAAATACCGTATATTATATAGTATCATATGAATTATGAAATGAAACAAAATATTGATCCTGGTTTGA
AGGTGGGTGGGCCTTACTGGGATGTTCCTGTGGGAAGAAAAGATTCAAAAACCGCAAGTTACGAGCTTGCCACAACAAACCTTCCAACTCCAGAAGAGGGTTTGATCAGCATCATTGCTA
AGTTCTACTCTCAAGGTCTCTCTGTTGAAGACATGGTCGCTCTTATAG
GTAAGATCAATCCTCTTAACCAAACTAAATCGAAAATTATGCTAAATTACTAAAACCCTAACTTGACCTATA
ATCTATCTAGGAGCGCACACAATCGGAAAGGCACAATGTCGGAACTTCCGATCCCGGATCTATGGAGATTTTCAGGTGACGTCAGCCCTAAATCCAGTTTCGGAGACGTACTTGGCAAGT
CTTCGAGAGATTTGTCCTGCAAGCAGCGGAGAAGGTGATAGCAATGTGACGGCGATGGACAATGTGACGCCAAATCTCTTTGATAACTCGATCTACCACACACTGCTAAGAGGAGAAGGG
TTACTGAATTCGGACCAGGAGATGTACACGAGCTTGTTCGGGATACAAACGCGGCGGATCGTGAGCAAGTACGCGGAGGATCCAGTGGCTTTCTTTGAGCAATTCTCGAAGTCGATGGTG
AAGATGGGGAACATTTTGAACTCTGAAAGCTTTGCTGATGGAGAAGTTAGAAGAAATTGCCGATTTGTCAACACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGACTCCTCCTTGTGTTCTTTATGGTTCTCGCCATCTTTATCCCCTGCTTTTCCTTTGATATACCGGGAAAGGATCTTCCTTTAATCCTAGATTATTACAAGTCTACTTGCCCAACC
GTATTTGACGTCATCAAGAAAGAAATGGAATGCATTGTGAAGGAAGATCCTCGAAATGCAGCCATAATTATTCGTTTACACTTCCACGATTGCTTTGTCCAA
GGATGCGATGGATCGGTG
TTGCTAGACGAAACAGCGACACTACAGGGAGAGAAAAAAGCTTCTCCCAACATAAACTCATTGAAAGGATACAATATTGTAGACAGAATCAAGAACATAATCGAATCTGAATGCCCTGGA
GTTGTTTCATGCGCTGATCTCCTCACAATTGGTGCTAGAGATGCTACAATCCTG
GTGGGTGGGCCTTACTGGGATGTTCCTGTGGGAAGAAAAGATTCAAAAACCGCAAGTTACGAGCTT
GCCACAACAAACCTTCCAACTCCAGAAGAGGGTTTGATCAGCATCATTGCTAAGTTCTACTCTCAAGGTCTCTCTGTTGAAGACATGGTCGCTCTTATAG
GAGCGCACACAATCGGAAAG
GCACAATGTCGGAACTTCCGATCCCGGATCTATGGAGATTTTCAGGTGACGTCAGCCCTAAATCCAGTTTCGGAGACGTACTTGGCAAGTCTTCGAGAGATTTGTCCTGCAAGCAGCGGA
GAAGGTGATAGCAATGTGACGGCGATGGACAATGTGACGCCAAATCTCTTTGATAACTCGATCTACCACACACTGCTAAGAGGAGAAGGGTTACTGAATTCGGACCAGGAGATGTACACG
AGCTTGTTCGGGATACAAACGCGGCGGATCGTGAGCAAGTACGCGGAGGATCCAGTGGCTTTCTTTGAGCAATTCTCGAAGTCGATGGTGAAGATGGGGAACATTTTGAACTCTGAAAGC
TTTGCTGATGGAGAAGTTAGAAGAAATTGCCGATTTGTCAACACATGA

Retrieve as FASTA