Entry information : AlyPrx54
Entry ID 7504
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx54
Name AlyPrx54
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx54
start..stop
S start..stop
AtPrx54 681 0 1..357 1..358
AruPrx54 659 0 1..357 1..358
BstrPrx43 657 0 1..357 1..358
CagraPrx23 639 0 1..357 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2550452..2550685 234 N° 2 2550156..2550347 192 N° 3 2549784..2549946 163 N° 4 2549212..2549696 485
complement(join(2549212..2549696,2549784..2549946,2550156..2550347,2550452..2550 685))


exon

Literature and cross-references AlyPrx54
DNA ref. Phytozome 12:   scaffold_6 (2550685..2549212)
Protein sequence: AlyPrx54
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (326)
PWM (Da):   %s   37085.16 (33907.6) Transmb domain:   %s   i13-35o
PI (pH):   %s   4.36 (4.34) Peptide Signal:   %s   cut: 32 range:32-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVTRSSSTCDGFFIISLIVIVSSLFGTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGASLIRLHFHDCFVNGCDGSLLLDDTGSTQSEKNAPANANSTRGFNVVDNIKTALENACPGIVSCSDVLALASEASVSLAGGPSWAVLLGRRDGLTANLSGANSLPSPFEGLNNITSKFVAVGLNTTDVVALSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQNGSASGITNLDLSTPDAFDKNYFTNLQSNNGLLQSDQELFSNSGSATVPIVNSFASNQTLFFEAFVQSMIKMGNISPLTGNSGEIRQDCKVVNGQSSATEAEDIQLQSDGPVSVADM

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAGATCTTCTTCTACTTGTGATGGTTTCTTCATCATCAGCCTTATTGTTATCGTTTCTTCATTGTTTGGGACATCATCTGCGCAGTTAAACGCAACGTTTTACTCTGGG
ACGTGCCCTAACGCCTCTGCCATCGTACGCAGCACTATTCAGCAAGCTCTTCAATCCGATGCAAGAATCGGAGCAAGCCTAATCCGCCTTCATTTTCACGACTGCTTTGTTAAT
GTATAA
GAAGCTCTTTAAATAAGCTTCTTGATTTTTACTTTATCATTAAGCCTTCTAAATTTTGTTACACTAAACCGCTACTTTGCTTCTTTACATTGGAAAAGGGTTGCGACGGGTCGCTCTTGC
TTGACGATACTGGAAGCACCCAGAGCGAAAAGAACGCTCCTGCCAACGCAAACTCAACTAGAGGATTCAATGTTGTCGATAATATCAAGACTGCCCTCGAGAATGCTTGTCCTGGCATTG
TCTCTTGCTCTGACGTTTTAGCTCTTGCATCAGAGGCCTCTGTGTCTTTG
GTAATAACACCACTTTCTTCATAAAACATATCAAACACAAAATTACGATACCTAAAGGCCGATCCTGGGC
TTGGCGGACCTGTCCACGGGCCTAATCACAGGCCGGGCCGGGCCGGGCCGGATAAAAAATATCCCTAATATTACCTAAAAAGCATGTTTTTAATATTCCTAATCTTGATAACATGTACAT
GTTTAATCATCTTCTTCAGGCAGGAGGGCCTTCATGGGCTGTGTTATTAGGAAGAAGAGATGGTCTCACTGCAAACTTGTCTGGAGCCAATTCTCTTCCCTCTCCCTTCGAAGGCCTTAA
CAACATCACATCTAAATTTGTAGCTGTCGGGCTAAATACAACCGATGTAGTAGCCTTGTCTG
GTAAATCATCGACATGTTCAATAACTTGCAGCTTAATTCAAACAAAACCCTAATTAGG
TCATTTCTGTTGTGGTTCAATATGCATAGGAGCGCATACGTTTGGGCGTGGTCAATGTGTAACGTTCAACAATAGACTATTCAACTTCAACGGGACAGGAAACCCCGACCCGACTCTGAA
CTCAACACTTCTCAGCAGCCTTCAACAGCTATGTCCTCAAAACGGCAGCGCATCAGGGATCACCAATCTCGATCTGAGCACACCTGATGCGTTCGATAAAAATTACTTCACAAACCTTCA
GAGTAACAATGGGCTTCTTCAGTCAGACCAGGAACTGTTCTCCAACAGCGGTTCAGCCACCGTCCCGATTGTTAATTCCTTTGCAAGTAACCAAACTCTGTTTTTTGAGGCGTTTGTTCA
GTCTATGATCAAGATGGGGAACATAAGTCCATTGACTGGGAATAGTGGAGAGATTAGACAAGATTGTAAGGTGGTCAATGGACAGTCATCAGCCACTGAAGCAGAGGACATTCAGTTACA
ATCTGACGGACCAGTGAGTGTAGCAGATATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAGATCTTCTTCTACTTGTGATGGTTTCTTCATCATCAGCCTTATTGTTATCGTTTCTTCATTGTTTGGGACATCATCTGCGCAGTTAAACGCAACGTTTTACTCTGGG
ACGTGCCCTAACGCCTCTGCCATCGTACGCAGCACTATTCAGCAAGCTCTTCAATCCGATGCAAGAATCGGAGCAAGCCTAATCCGCCTTCATTTTCACGACTGCTTTGTTAAT
GGTTGC
GACGGGTCGCTCTTGCTTGACGATACTGGAAGCACCCAGAGCGAAAAGAACGCTCCTGCCAACGCAAACTCAACTAGAGGATTCAATGTTGTCGATAATATCAAGACTGCCCTCGAGAAT
GCTTGTCCTGGCATTGTCTCTTGCTCTGACGTTTTAGCTCTTGCATCAGAGGCCTCTGTGTCTTTG
GCAGGAGGGCCTTCATGGGCTGTGTTATTAGGAAGAAGAGATGGTCTCACTGCA
AACTTGTCTGGAGCCAATTCTCTTCCCTCTCCCTTCGAAGGCCTTAACAACATCACATCTAAATTTGTAGCTGTCGGGCTAAATACAACCGATGTAGTAGCCTTGTCTG
GAGCGCATACG
TTTGGGCGTGGTCAATGTGTAACGTTCAACAATAGACTATTCAACTTCAACGGGACAGGAAACCCCGACCCGACTCTGAACTCAACACTTCTCAGCAGCCTTCAACAGCTATGTCCTCAA
AACGGCAGCGCATCAGGGATCACCAATCTCGATCTGAGCACACCTGATGCGTTCGATAAAAATTACTTCACAAACCTTCAGAGTAACAATGGGCTTCTTCAGTCAGACCAGGAACTGTTC
TCCAACAGCGGTTCAGCCACCGTCCCGATTGTTAATTCCTTTGCAAGTAACCAAACTCTGTTTTTTGAGGCGTTTGTTCAGTCTATGATCAAGATGGGGAACATAAGTCCATTGACTGGG
AATAGTGGAGAGATTAGACAAGATTGTAAGGTGGTCAATGGACAGTCATCAGCCACTGAAGCAGAGGACATTCAGTTACAATCTGACGGACCAGTGAGTGTAGCAGATATGTAA

Retrieve as FASTA