Entry information : AlyPrx22
Entry ID 7505
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx22
Name AlyPrx22
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx22
start..stop
S start..stop
AhalPrx38 699 0 1..349 1..349
AtPrx22 685 0 1..349 1..349
AruPrx23 645 0 1..349 1..349
AlyPrx23 640 0 1..349 1..349
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18640910..18641137 228 N° 2 18641283..18641474 192 N° 3 18641557..18641725 169 N° 4 18642157..18642617 461
join(18640910..18641137,18641283..18641474,18641557..18641725,18642157..18642617 )


exon

Literature and cross-references AlyPrx22
DNA ref. Phytozome 11:   scaffold_4 (18640910..18642617)
Protein sequence: AlyPrx22
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (320)
PWM (Da):   %s   38011.01 (35139.7)  
PI (pH):   %s   5.14 (5.14) Peptide Signal:   %s   cut: 30 range:30-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFSPSFSCSAMGALILGCLLLQASNSNAQLRPDFYFGTCPSVFDIIGNIIVDELQTDPRIAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNANSARGFNVIDRMKVELERACPRTVSCADILTIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFFTLTQLKKAFADVGLDRASDLVALSGGHTFGRAQCQFVTPRLYNFNGTNSPDPSLNPTYLVELRRLCPQNGNGTVLVNFDVVTPDAFDSQYYTNLRNGEGLIQSDQELFSTPGADTIPLVNLYSSDMSVFFRAFVDAMIRMGNLRPLTGTQGEIRQNCRVVNPRIRVVEHDDGVVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCTCCTTCATTTTCTTGCAGTGCTATGGGAGCCCTAATTTTGGGTTGCCTTCTGCTTCAAGCATCAAACTCTAATGCTCAGTTGAGGCCTGATTTCTACTTCGGGACTTGC
CCATCTGTTTTTGATATCATTGGGAATATCATCGTTGACGAATTGCAGACTGATCCTCGTATTGCCGCGAGCCTCCTTCGTCTTCACTTCCATGACTGTTTTGTTCGT
GTAAGGACTTAC
TCAACTTATCTTTTACAAAACAAATTCCACGACGTCTACTTTCGCATACCATTTACATATATAATCGAGATTAAAAGCCATTTCTAATTAATAAATAATATCGTCATCTAATGTAATAAA
TATGATTTTGTAGGGTTGTGATGCATCGATCTTGCTTGACAATTCCACATCATTCCGGACCGAGAAAGATGCTGCTCCAAACGCAAATTCGGCTCGAGGGTTTAATGTCATAGATAGAAT
GAAAGTAGAACTTGAGAGAGCTTGCCCAAGAACAGTATCTTGTGCAGATATTCTCACCATCGCCTCTCAAATATCCGTGCTTTTG
GTATATAAATATACTTACATGACTTATCTCGTATG
AAACTAATCCAAAAAGGTTATGAATTTGACGTCAATGTTTTATATAGTCCGGAGGTCCATGGTGGCCGGTTCCGTTGGGGAGGAGAGACAGTGTAGAAGCTTTCTTCGCTCTGGCTAATA
CAGCTCTTCCCTCTCCATTTTTCACTCTTACTCAACTTAAAAAAGCTTTTGCTGATGTTGGTCTAGACCGCGCCTCGGATCTAGTCGCTCTTTCTG
GTAAAATTTTCATGCATGTTTTAT
CATCTAAGATGTGATATTGATAACATATTTTTTCTTTATAAAAACTAAAAATTTTAAATAGTATATGAACATAACAATTGAAGTAGCTTTGTCAAATAAATTTATAGTAATAGTTCATAA
AATAAAATGGGGTGTTATTTATCTACAATGTTTAAGTTCGAATCTTAGCACAATATATTTAGTTTTTAAAAAGTTTTTCAAGGCATATGAATTAATTAGCATGAGTTAGAGGTAAGAAAC
TCCATTTGCTTGAAATACATGACCAAATAGCTGTTCAGAAAAAACATGACCGAATATAAAATGAAAAAAGAGGAAAAAAAATCTAATCTAATACGAATTTCATGCGTTGGTAAACGACAA
CTTAACATTCCATGTATCTAAGCCTTTATGTTTTGTCAAAATGGTAGGTGGTCACACATTTGGAAGAGCACAATGCCAATTCGTGACACCTCGTCTCTACAACTTCAACGGAACCAACAG
TCCAGACCCAAGTCTGAACCCAACTTACCTCGTCGAACTCCGTCGCTTGTGCCCTCAAAACGGAAACGGTACCGTTCTGGTCAACTTCGATGTCGTGACTCCAGATGCTTTCGATAGTCA
ATACTATACCAATCTTCGTAATGGGGAAGGTCTTATTCAGAGTGACCAAGAACTCTTTTCAACTCCAGGAGCCGATACGATCCCACTAGTAAACCTATACAGCAGCGACATGTCTGTGTT
CTTTCGAGCATTCGTTGACGCAATGATTAGGATGGGAAATCTTAGACCTTTGACTGGAACTCAAGGAGAGATAAGACAGAATTGTAGGGTTGTGAATCCACGAATTAGGGTTGTGGAGCA
CGACGATGGTGTTGTGAGTTCTATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTTTTCTCCTTCATTTTCTTGCAGTGCTATGGGAGCCCTAATTTTGGGTTGCCTTCTGCTTCAAGCATCAAACTCTAATGCTCAGTTGAGGCCTGATTTCTACTTCGGGACTTGC
CCATCTGTTTTTGATATCATTGGGAATATCATCGTTGACGAATTGCAGACTGATCCTCGTATTGCCGCGAGCCTCCTTCGTCTTCACTTCCATGACTGTTTTGTTCGT
GGTTGTGATGCA
TCGATCTTGCTTGACAATTCCACATCATTCCGGACCGAGAAAGATGCTGCTCCAAACGCAAATTCGGCTCGAGGGTTTAATGTCATAGATAGAATGAAAGTAGAACTTGAGAGAGCTTGC
CCAAGAACAGTATCTTGTGCAGATATTCTCACCATCGCCTCTCAAATATCCGTGCTTTTG
TCCGGAGGTCCATGGTGGCCGGTTCCGTTGGGGAGGAGAGACAGTGTAGAAGCTTTCTTC
GCTCTGGCTAATACAGCTCTTCCCTCTCCATTTTTCACTCTTACTCAACTTAAAAAAGCTTTTGCTGATGTTGGTCTAGACCGCGCCTCGGATCTAGTCGCTCTTTCTG
GTGGTCACACA
TTTGGAAGAGCACAATGCCAATTCGTGACACCTCGTCTCTACAACTTCAACGGAACCAACAGTCCAGACCCAAGTCTGAACCCAACTTACCTCGTCGAACTCCGTCGCTTGTGCCCTCAA
AACGGAAACGGTACCGTTCTGGTCAACTTCGATGTCGTGACTCCAGATGCTTTCGATAGTCAATACTATACCAATCTTCGTAATGGGGAAGGTCTTATTCAGAGTGACCAAGAACTCTTT
TCAACTCCAGGAGCCGATACGATCCCACTAGTAAACCTATACAGCAGCGACATGTCTGTGTTCTTTCGAGCATTCGTTGACGCAATGATTAGGATGGGAAATCTTAGACCTTTGACTGGA
ACTCAAGGAGAGATAAGACAGAATTGTAGGGTTGTGAATCCACGAATTAGGGTTGTGGAGCACGACGATGGTGTTGTGAGTTCTATTTGA

Retrieve as FASTA