Entry information : AlyPrx64
Entry ID 7506
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx64
Name AlyPrx64
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx64
start..stop
S start..stop
AhalPrx17 655 0 1..317 1..317
BstrPrx12 641 0 1..317 1..317
AtPrx64 639 0 1..317 1..317
CrubPrx43 638 0 1..317 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7424716..7424919 204 N° 2 7424429..7424617 189 N° 3 7424171..7424333 163 N° 4 7423564..7423961 398
complement(join(7423564..7423961,7424171..7424333,7424429..7424617,7424716..7424 919))


exon

Literature and cross-references AlyPrx64
DNA ref. Phytozome 12:   scaffold_8 (7424919..7423564)
Protein sequence: AlyPrx64
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (295)
PWM (Da):   %s   34443.53 (31957.2)  
PI (pH):   %s   9.26 (9.43) Peptide Signal:   %s   cut: 23 range:23-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAHMLNLLVMVIFVVTFDVQALSPHYYDHTCPQADHIVTNAVKKAMSNDKTVPAALLRMHFHDCFVRGCDGSVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGIVSCADILSLAARDAVALSGGPTWAVPKGRKDGRISKAIETRQLPAPTFNISQLRQNFGQRGLSMHDLVVLSGGHTLGFAHCSSFQNRLHNFNTQKEIDPTLNPSFAASLEGVCPAHNKVKNAGSTLDGTVTSFDNIYYKMLIQGKSLFSSDEALLAVPSTKKLVAKYASSNEEFKRAFVKSMIKMSSISGSGNEVRLNCRRVR

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACACATGCTCAATCTCCTTGTCATGGTTATCTTCGTAGTTACTTTCGATGTCCAAGCACTCAGTCCTCACTACTACGACCATACATGTCCACAAGCCGACCACATTGTCACC
AATGCAGTCAAGAAAGCCATGTCAAATGACAAAACTGTCCCTGCCGCGCTTTTGAGGATGCATTTCCACGACTGTTTCGTCAGA
GTAACAACTACTTACACACTACATTCTCTTCATCTC
TCAATCTTCTATGTGTTTATACTCTAATTAATGTTGTTGGTGAATATTTTTGATCATTAAAGGGATGTGATGGGTCAGTTCTTTTAGACTCAAAGGGAAAGAACAAAGCAGAGAAAGATG
GACCTCCTAACATATCACTACATGCATTTTATGTGATTGACAATGCAAAGAAGGCATTAGAAGAGCAATGTCCCGGTATCGTCTCTTGCGCCGACATTCTTTCACTCGCTGCAAGAGATG
CTGTCGCTCTC
GTGAGTCTCTCTCCATCTCATATTCCAAATACTACTTTTATTTGATGATTCTATTAACAATCCACCTAAAATATTCTATGTGGATGTGACTATAGTCAGGAGGGCCAAC
ATGGGCAGTGCCAAAAGGTAGAAAAGATGGAAGAATTTCAAAGGCAATAGAAACAAGACAACTACCAGCTCCTACTTTCAACATTTCTCAATTACGTCAAAATTTTGGCCAAAGAGGCCT
CTCTATGCATGATCTTGTTGTTCTCTCTG
GTATTCAACATTCTCTCACTCATTTAAAATATATTTTTAAAGATTTCTAAAATATTTTTATTATACTATTCTAAAAGATGTAACATAGATA
TATGAAAAAAAAAAAAAAAAAAAAAAAAAATTCTAAATCCTAAAAGTAATTGGAAAATTACAAATATAGCTCCAATGCTTATAATGGTATAAATTTGGAATGTTGAATGAAATGGCAGGA
GGTCACACACTAGGATTCGCCCACTGCTCATCGTTCCAGAATAGGCTCCATAACTTCAATACACAAAAGGAGATTGATCCAACGCTAAACCCATCGTTCGCAGCCAGCTTGGAGGGAGTG
TGTCCAGCCCATAACAAGGTGAAGAACGCTGGATCGACCTTGGATGGAACCGTGACGTCATTTGACAATATCTACTACAAGATGCTTATTCAAGGCAAGTCACTATTCTCATCCGACGAA
GCGCTTCTCGCAGTGCCCTCTACTAAGAAACTCGTGGCAAAGTACGCGAGTTCCAACGAAGAGTTCAAGAGGGCTTTTGTGAAATCCATGATCAAGATGAGTAGTATCAGTGGGAGTGGT
AATGAGGTCAGACTTAACTGCAGAAGGGTTCGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACACATGCTCAATCTCCTTGTCATGGTTATCTTCGTAGTTACTTTCGATGTCCAAGCACTCAGTCCTCACTACTACGACCATACATGTCCACAAGCCGACCACATTGTCACC
AATGCAGTCAAGAAAGCCATGTCAAATGACAAAACTGTCCCTGCCGCGCTTTTGAGGATGCATTTCCACGACTGTTTCGTCAGA
GGATGTGATGGGTCAGTTCTTTTAGACTCAAAGGGA
AAGAACAAAGCAGAGAAAGATGGACCTCCTAACATATCACTACATGCATTTTATGTGATTGACAATGCAAAGAAGGCATTAGAAGAGCAATGTCCCGGTATCGTCTCTTGCGCCGACATT
CTTTCACTCGCTGCAAGAGATGCTGTCGCTCTC
TCAGGAGGGCCAACATGGGCAGTGCCAAAAGGTAGAAAAGATGGAAGAATTTCAAAGGCAATAGAAACAAGACAACTACCAGCTCCT
ACTTTCAACATTTCTCAATTACGTCAAAATTTTGGCCAAAGAGGCCTCTCTATGCATGATCTTGTTGTTCTCTCTG
GAGGTCACACACTAGGATTCGCCCACTGCTCATCGTTCCAGAAT
AGGCTCCATAACTTCAATACACAAAAGGAGATTGATCCAACGCTAAACCCATCGTTCGCAGCCAGCTTGGAGGGAGTGTGTCCAGCCCATAACAAGGTGAAGAACGCTGGATCGACCTTG
GATGGAACCGTGACGTCATTTGACAATATCTACTACAAGATGCTTATTCAAGGCAAGTCACTATTCTCATCCGACGAAGCGCTTCTCGCAGTGCCCTCTACTAAGAAACTCGTGGCAAAG
TACGCGAGTTCCAACGAAGAGTTCAAGAGGGCTTTTGTGAAATCCATGATCAAGATGAGTAGTATCAGTGGGAGTGGTAATGAGGTCAGACTTAACTGCAGAAGGGTTCGCTAG

Retrieve as FASTA