Entry information : AlyPrx15
Entry ID 7507
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-27 (Christophe Dunand)
Peroxidase information: AlyPrx15
Name AlyPrx15
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx15
start..stop
S start..stop
AhalPrx05 694 0 1..339 1..339
AtPrx15 672 0 1..339 1..338
BstrPrx49 652 0 1..339 1..337
CrubPrx71 633 0 1..339 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22566428..22566673 246 N° 2 22566128..22566319 192 N° 3 22565884..22566049 166 N° 4 22565365..22565780 416
complement(join(22565365..22565780,22565884..22566049,22566128..22566319,2256642 8..22566673))


exon

Literature and cross-references AlyPrx15
DNA ref. Phytozome 12:   scaffold_3 (22566673..22565365)
Protein sequence: AlyPrx15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (323)
PWM (Da):   %s   37196.12 (35370.1)  
PI (pH):   %s   5.49 (5.25) Peptide Signal:   %s   cut: 17 range:17-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIGSFLIILYLTYALTLCICDDDESMYYGGNKGNLFPGFYRSSCPRAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSILTGGPSWMVPLGRRDSRSASLSGSNNNIPAPNNTFNTIVSRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQFGNGSPDSTLEQSYAANLRQRCPRSGGDQNLSELDINSAGRFDNSYFKNLIEKMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATAGGAAGCTTTCTCATTATTCTTTATCTCACTTACGCTCTTACTCTCTGCATCTGCGATGACGACGAGAGTATGTACTATGGCGGCAACAAAGGGAACCTCTTCCCAGGT
TTCTACAGAAGCTCGTGTCCTAGAGCCGAGGAGATTGTGAGGTCAGTTGTAGCCAAAGCTGTTGCAAGGGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTCCACGATTGTTTC
GTTCAG
GTACTAGAGAGTTTGTTTTTTTAAGTAACTTTCCCAACAAGCTAACTACTAATGCTGAGAAATGAGAATCATAACTAATTTTATCTATTTCAATGAAAAAATGTGCAGGGTTGT
GATGGATCGTTGCTTCTAGACACCAGTGGGAGTATAGTTACTGAGAAGAACTCTAACCCTAACAGTAGGTCGGCTCGCGGGTTTGAAGTTGTTGACGAGATCAAGGCTGCATTGGAGAAT
GAATGCCCTAACACTGTTTCTTGTGCTGACGCCTTAACTCTAGCCGCTAGAGACTCTTCTATTCTT
GTAAGTCATCTTCTTTCTATGTCTCTCTCTATTGCTTCTTTAAGTTCTCAAGAT
CTAATTTGGTTCGTTTGTGTGTAGACTGGTGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCGAGAAGTGCAAGCTTGAGCGGATCAAACAACAACATTCCTGCACCCAACAAC
ACTTTCAACACAATTGTCTCGAGATTTAACAATCAAGGTCTCGATCTCACCGACGTTGTTGCTCTCTCCG
GTAAGCTTACTTCACACACAAGGAAGAAATTACTTTACTTGCTTCTGAAG
TAAAGGTTAACCTAAAAAGCGGTTTTATCATAATCTGACTCAAAAATTTTCAGGGAGCCACACCATTGGATTTTCAAGATGCACTAGTTTCAGACAGAGACTTTACAACCAATTCGGAAA
TGGAAGTCCGGACTCAACCTTAGAGCAATCCTACGCTGCTAACTTACGCCAGAGGTGCCCTAGATCGGGTGGGGATCAGAACCTGTCGGAGCTTGACATCAACAGCGCCGGAAGATTTGA
TAACAGCTATTTCAAGAACTTGATCGAGAAGATGGGACTGTTGAATTCCGACGAGGTCTTGTTCTCTAGCAATGAGCAATCGAGAGAGCTGGTGAAGAAGTATGCAGAGGATCAAGAAGA
GTTCTTCGAGCAGTTTGCGGAGTCGATGATCAAGATGGGGAATATCTCTCCCTTGACAGGTTCGAGTGGTGAGATCAGAAAGAATTGCAGGAAAATTAATAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATAGGAAGCTTTCTCATTATTCTTTATCTCACTTACGCTCTTACTCTCTGCATCTGCGATGACGACGAGAGTATGTACTATGGCGGCAACAAAGGGAACCTCTTCCCAGGT
TTCTACAGAAGCTCGTGTCCTAGAGCCGAGGAGATTGTGAGGTCAGTTGTAGCCAAAGCTGTTGCAAGGGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTCCACGATTGTTTC
GTTCAG
GGTTGTGATGGATCGTTGCTTCTAGACACCAGTGGGAGTATAGTTACTGAGAAGAACTCTAACCCTAACAGTAGGTCGGCTCGCGGGTTTGAAGTTGTTGACGAGATCAAGGCT
GCATTGGAGAATGAATGCCCTAACACTGTTTCTTGTGCTGACGCCTTAACTCTAGCCGCTAGAGACTCTTCTATTCTT
ACTGGTGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGAT
TCGAGAAGTGCAAGCTTGAGCGGATCAAACAACAACATTCCTGCACCCAACAACACTTTCAACACAATTGTCTCGAGATTTAACAATCAAGGTCTCGATCTCACCGACGTTGTTGCTCTC
TCCG
GGAGCCACACCATTGGATTTTCAAGATGCACTAGTTTCAGACAGAGACTTTACAACCAATTCGGAAATGGAAGTCCGGACTCAACCTTAGAGCAATCCTACGCTGCTAACTTACGC
CAGAGGTGCCCTAGATCGGGTGGGGATCAGAACCTGTCGGAGCTTGACATCAACAGCGCCGGAAGATTTGATAACAGCTATTTCAAGAACTTGATCGAGAAGATGGGACTGTTGAATTCC
GACGAGGTCTTGTTCTCTAGCAATGAGCAATCGAGAGAGCTGGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTTGCGGAGTCGATGATCAAGATGGGGAATATCTCT
CCCTTGACAGGTTCGAGTGGTGAGATCAGAAAGAATTGCAGGAAAATTAATAACTCTTGA

Retrieve as FASTA