Entry information : AlyPrx[P]68
Entry ID 7509
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-01-27 (Christophe Dunand)
Peroxidase information: AlyPrx[P]68
Name AlyPrx[P]68
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx[P]68
start..stop
S start..stop
AlyPrx67 320 2e-111 1..201 68..309
AhalPrx62 320 2e-111 1..201 76..317
AtPrx67 310 2e-107 1..201 68..309
CagraPrx29 308 2e-106 1..201 76..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18579071..18579263 193 N° 2 18569077..18569531 455  
complement(join(18569077..18569531,18579071..18579263))


exon

Literature and cross-references AlyPrx[P]68
DNA ref. Phytozome 12:   scaffold_8 (18579263..18569077)
Protein sequence: AlyPrx[P]68
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   215
PWM (Da):   %s   23253.97  
PI (pH):   %s   9.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CDGSILLDDTPSFLGEKTAGPSNKTVRGFEVIDKIKFKIEKMCPGIVSCADILAITARDSVLLVxxxxFAPDGMVALSGAHTIGRAQCVTFRNRIYNESNIDTSFAISRRKSCPAANGSRDNKEANLDVRTPDRFDHNYYKQLLSNKGLLTPDQVLFNNGPTDSIVVSYSRSVRSFYRDFVTAMIKMGNISPLTGLGLGIRFRFGCIRFRLVWIW

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo). Only exons 2 and 4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGACGGATCCATACTATTGGACGACACACCGTCATTTTTGGGAGAGAAAACCGCGGGACCCAGCAATAAGACTGTGAGGGGATTCGAAGTGATCGACAAAATCAAGTTTAAGATTGAG
AAAATGTGCCCAGGCATCGTCTCATGCGCAGACATTCTCGCCATCACTGCTCGTGACTCTGTTCTCCTCGTTA
GCACCTCTACCGTTTAACTATTTGTCATTTATAAATGACTCCGCCTT
CCCTACCGGAGTTCGACTCCACTAAATCGCGTTACCCCGCGTAGTAGGAATTGACTATGGATCGGGCCTTGTCGATCCAAATATGTTAAAAAAAAAAAAAAAAGATGCGTTCTGATGCAG
CGCATCTTCACTACTTGTTGGGCCTCGTTAACGTATCTCGTGCCCATCAAGATATTCAGTTGTAACAAGATCATTTCCTTAGTTTTCGAGACATTATCACTTCGTTTACGTTTTGTTATC
ATAGGATATTCTTAATATCTTTTAGGATTAGGATTAGTTTTTGAAGATGTAGCTGCAGTCTGATGAAGTTGTTGAATGAGTCAAGAAGTAAAACAAGATTTTGTCTGATGGAGTTTCTGA
ATGATTCAAGAAGTATGTCAAGATGCGACTGTTTTTGTGTGAGTGTCGGTTTCTAGAAGGTTTGAGAAGATGTGTTTGGAGCGTGTTTAGAGGATGAATCACAAAGGAAAAAGGACTTAA
AGAGATTTGGAAGACTTGATGAAAGTGGAGTTTGAAGAGAAAAAGGAAAAGTATAAAAGGAAATTTACTTTTTCTTATGGAAATTGGAAATCTTCTCCTATGGTGATTAGGAAATCGTTT
TGGCTATATAAGGAGGAGCTGAGGACGTCTTTGAGAGGCAAGAGAGCTGAGGCATAAAGAAGAAATCTTTGAGAGCTTTCGGTGAGATTGTGTGCAACTTAGTTTTGCGGATTTGTGCTT
GTGTGATCAAGTGGTTTTGTTTTGAAGTGTAGGCTCAAGGGGAGTTTAGCTCAGGGTTAGGTTATCCTGATTAAATCTAGACTCAAGGGGAGTTTAGTTAAGGGTAGAGATTATCCTTAA
GGTTTCACGTTATAGAAGGGAGCGGTAAATCAAGAGGGTTGGGCTTGTTTTACGCGTTTGCGAATTGGTTGTAATTTGCTTTCTTGTTCTAGTGGAATCGAAATCTGGACGTGGTCCCGG
GGAGTAGGAAAAACCGAACCTCGTTAACAAATTTCTTGTCTCGTTTACTTTCTACAATTTATCGTACCTCATCCGCACTTACAATTGGTATCAGAGCGGGTTCTCGATAGAGATTTAGTC
TTGTTTCGGGTAGATCAGGGTGAGGTTCAGGAGATCGTTCAGAAGATCGTTCAGGAGATCATTCAGAAAGTAAGACAGAGCTGAGAATCGTGTGAGATGGAGTCATACAAGGAAGGTACG
TCTATGACAAGACCACCACTTCTTGATTCAGCGAATTATGGATATTGGAAGGTTCGTATGCAAGCTTTTATTAGTAATCTTGATGAAGATTGTTGGAATTCAATTGAACTTGGTTGGGAG
GCTCCTAAAGTTACGGATGATGATGGAGTTGTAAGTCTCAAGCCAAGAGATAAGTGGACTGCTGCAGAGAAAAAGCTATCAAGTTGCAATTCTAAGGCTAAGACTGCGATTTACAATGCT
ATTGATTCAAGCCACTTTAAGTTGATTTCTCAATGTGCATCAGCTCAAAAAGCATGGAAGACATTGGAGAATATGTTTGAGGGTACTACAAGCGTTAAGAGAACGAAATTAGATATGTTA
GCTTCGCAATTTGAGAATCTAAGGATGGAAGAAGAGGAAAATGTGGCTGATTTTAGTGCAAAGTTATGTGACATATCTAATGAATCGTTTGCTCTTGGAAAGGTCTACAAGGACAAAAAG
CTAGTGAAGAAGTTGAAGAGATCATTACCTGCAAAATTTGAGTCAAAGATTTCTGCAGTTGAAGAAGCTCATAATCTAGATGAGATGGCTTTTGATGAGTTTGTTGGGATTCTTCAAGCT
TTTGAGTTAAGCAAATCATATGAAACTAAAGGAAAGATGAAGAAGGTAGATGAAGTGAAGAAGGAAGTTGACATTGGAGTTGCTCTTAAGGGAACATCAACTGAAAACTGAAGATTCAAT
GGCTATGTTGTCAAGACAGTTTACTAAATATCTGAAACGAAAGGGAAAAGAGAGGAGAAGTTCATCAAAGAATGTGCAATGTTTTGAATGCAAAGGATATGGACATGTTCGTTCGGAATG
CGCCAATATGTTCGTTCGGAATGCGCCAATCTACAAAAGCATAAGAAGAAGGCCATGAATGTTGTCACTAGTGATTCTGAAACTGATTCAGATGAAGAAGAAGAAGATCTGAAGAATTTT
GTGGCTTTGACAACTTTCAATTCTAGTTCAGATATAGATTCTGCGTCAGTTTCTGAATTAGTGTCTGCATCAGTGTCTGCAACAGGGTCTGCATCAGCATCTGCAACAGGGTCTGCATCA
GCATCTCCAACAGGACCTGCACTTAAAAGTGAAAACGATGAATGCGAGAGTGATGCAGAGAGTATTGATGATGAAGAATTTGCTGAGAATTACAGAGTTTTATATGAGCATTGGCTTAAA
ATGGTTGAGGAGAATTCAATGTTAACTAAGGAGAAACTCAAGTTAGAGGCTAAAGTCATTGAAGTACAGAAATATGCTGCAGAAAAAGAAGAAGAAGCATCACAAGCCAAAGTACAACTT
GAAGAAACTCAAAAGAATTTGAGGATGCTTAATAATGGCACAAAGAAGTTGGATCATATTCTGAATATTGGCAAGATTGATAAGTGTGGCCTTGGATTTGAAGGAAAACTTTCAAAATCA
GATCCAGTGTTTGTTTATGGTGGAAAAATCACATCTGGATCAGGAAGTGTGTCAGAAACTGCAACTATGGCAGAGACTGCGTCAGGTACAAGAACTACTACGAGAACTGGTACAGAGTCT
GATACAGGAAAAGGTAAAGAACTGCAGAGTGCACCTCAACGAATTTTTCGACCTGTTTGCCATCATTGTGGTATTGTTGGGCATATTAGGCCAAGGTGTTTCAGATTATTGAGGGAGAGA
AATCGAATGGAGAATGCTTATGATAAGAGATTTCATGGTCCTACATGTTATCATTGTGGAGTTCAAGGGCATATTAAGAGGAATTGTTTCAGATTCATTCGAGAATCCAGTCATGAAGGC
TTAAGGCGCAGGAAGATTTGGGTTAGGAAAGATGATTTCTATGGAGGTGGTGTACTAGGCTATCAACCTCGTGTTGCAAAGCGGGGAGAATTTTCTAAGTAGTTTTGACCATGTTGTGAC
TCATTCAGGGGGAGAATGATGATGTGTTTCGTGATGTTGTTTTGGAGTTAGAACTGTTGAGTTCACAAACATAGTCAAAAAGGGGGAGATTGAAGATGTAGCTGCAGTCTGATGAAGTTG
TTGAATGAGTCAAGAAGTAAAACAAGATTTTGTCTGATGGAGTTTCTGAATGATTCAAGAAGTATGTCAAGATGCGACTGTTTTTGTGTGAGTGTCGGTTTCTAGAAGGTTTGAGAAGAT
GTGTTTGGAGCGTGTTTAGAGGATGAATCACAAAGGAAAAAGGACTTAAAGAGATATGGAAGACTTGATGAAAGTGGAGTTTGAAGAGAAAAAAGAAAAGTATAAAAGGAAATTTACTTT
TTCTTATGGAAATTGGAAATCTTCTCCTATGGTGATTAGGAAATCGTTTTGGCTATATAAGGAGGAGCTGAGGACGTCTTTGAGAGGCAAGAGAGCTGAGGCATAAAGAAGAAATCTTTG
AGAGCTTTCGGTGAGATTGTGTGCAACTTAGTTTTGCGGATTTGTGCTTGTGTGATCAAGTGGTTTTGTTTTGAAGTGTAGGCTCAAGGGGAGTTTAGCTCAGGGTTAGGTTATCCTGAT
TAAATCTAGACTCAAGGGGAGTTTAGTTAAGGGTAGAGATTATCCTTAAGGTTTCACGTTATAGAAGGGAGCGGTAAATCAAGAGAGTTGGGCTTGTTTTACGCGTTTGCGAATTGGTTG
TAATTTGCTTTCTTGTTCTAGTGGAATCGAAATCTGGACGTGGTCCCGGGGAGTAGGAAAAACCGAACCTCGTTAACAAATTTCTTGTCTCGTTTACTTTCTACAATTTATCGTACCTCA
TCCGCACTTACAGTTTTATTTGCTTTTATCTCACGACTCTATATAAAGAGATCGTCTTCCCTGTAATCAAATCATCTTTGGCTTTAAGAATTCATTTGAAAACCTAAAGAGCTTGCTTTG
TGCGAACCCTGAGAGGAGGACTCTCGCCTTTTGTTTCTCGATCTCAATTCATCATTGAGCTCGTTTATCTCTGTTTCGTTGCAACCTTCACCATACTCTGTTTTGACTTCACTAAAACAG
AGCCCCCTTCCACCTAACCTTGTTCTAAGCTTCCACTTCTAATCTCTCTTTAAATTGCTTCCGCTCCCTCTATCAGTTGGTATCAGAGACAAAACGTTTCTGAAAAGTTGAAATCTCGAC
CATGCCACCAAAGAAAGACGACGAGATCGCCGCCGCAAATTGGGCTGAACTGCGAGCCGCCCTATCCACCCTCCTTGCGTTGCAGGAGACGATGCAGTCCAACATTCAAACCACCATTCA
AGCCTCGATACGTGAACTTGGAGAAACTCTGACTCAACACTTACAACCACGACAACAGGCCGGAGACCAAAGAAACGAGATCGCAGAAGTGAACCCGTTTGCTCCTGATGGCAATCGCGA
GTTGATCGTAAGGAGACCAGATCAGCGTGATTCACGATGGGAAGCTGGCTTCAAGGTTGATATTCCCGAATTCAGCGGAGGACTGCGAGGTGATACCTTGTTAGATTGGTTGGTCGCCGT
AGAAGAGGTCCTGGATTATAAACAAGTACCAAACAATCGTCGTGTACCTCTCGTAGCCACAAAATTTCGCGGGCACGCAGCATCTTGGTGGCAGCAACTAAAAGCCTCTCGCAATCGCGA
CAATAAAGCACCGATCGACTCTTGGGAAAAATTGAAGAAGAAGCTGAGGCAAACTTTCTTACCTCACAATTACGACCGCACCATGTACACGCGGCTTCAAAATTTGAAACAAGGGATGCG
TTCTGTAGATGAATATGCTGAGGAGTTTTATGTCCTACTCACTAGGAATGAAATCAATGACAATGAGGTGCAGCTCGTGTCTCGTTTCATCGGTGGGTTGCGAAGTCAACTCCAGAATTC
ACTACCTCAATTCGATCCAACCTCCATAGCCAAAGCTCATCGTCGTGCAGCCTCTTTTGAACAACAACAACGCTCCGGAAATTGGTCCTCTACCTCCAATCGTGGACGGGTTCAAGAGAT
GAATTCTCCCAAATCGGAGACTGCAACAAAAGAGAATACGGATACCGCTACGCCAAAACAAATAGAGGATCCAGCCTTGCGCCGTTCCAGTCGCAATGCCCTGCGGTGTTTTAATTGCGG
TGAACCAGGACACAGGCAGACCGCATGCCCACAACAGACAAGACGCGGCCTCCTTGTTGATGAACAACCCAACGATGATGAGCCACTGTATGACTCTGAAGAAGAAGATCGGAGTAACAA
TGACACTGTGTTACACCATACACATGGTGATAACGGACCATTGTTGTTAGTAGGACGTACTTGTCTCATTCCAGAAGCAAAAACAGAGTCTTGGTTACGGACTAACATTTTTCGCTCCAC
TTGCACCATCAAAGGACGACTCTGTACCGCCATTTGCAGCTTCATCATAGACTCCGGCAGCTCGCGCAACGTCATAGCAGAAGAAGCAGTTCGAAAATTAGGCCTACTGGTTGAAGCACA
TCCTGCTCCTTACAATATTGGTTGGCTTAGTGACAAAGTGAATATGCGTGTCACTCATCGCTCTATGGTGCCTTTCTCCATAGGACCTTACTACAAGGACCATATGTATTGCGATATCGC
TCCTATTGATGTTTGCCACTTGTTGTTAGGAAGACCTTGGGAATACGACCGCAAGATCACTCACGACGGGTTGAAAAACACATATCGATTCGTGTGGGAAACTCACCAAATCTTACTCAT
GCCATCACGAGAACCAGTAGCAGCTGAACCTCCTCCCACGCGATCAGTCCAAAGCCGTTTGTCTTTCCCTCCAAAAATTACCGACGCAACACAAGCTCATACACCACGATCAGTCCATAG
CCGTTTAACTTTTCCAGAAATGGCTCCCGAGTCGACACTCCTCTGTTCTTACTCCATGTTTGATCAAGAATTTCGTAAAGAGGGCATGGCTTATGCACTCTTACTTGCGGGAACAAAGGA
GCAACGACCAACGGTGTTGTCACCACAATTTGAGCCGATCCTTCGGGAATTTACAGATGTGTTTCCAAGTGAGTTACCACCAGGGCTTCCTCCACTTCGCGACATTCAACACCAGATCGA
TCTCATCCCGGGGGCCACACTCCCGAACCGTCCTCATTATCGAATGAGTCCACTTGAACATGAAGAGCTACGACGCCAGGTAGAAGAGTTACTCCATAAAGGCTATATTCGGGAAAGTCT
AAGTCCATGTGCTGTTCCCGCGCTCTTAATTCCAAAGAATGATGGTTCTTGGCGAATGTGTGTGGATAGCCGAGCCATCAATAAAATCACAACTCGCTACCGTTTTCCGATTCCACGCCT
TGATGACCTACTGGACCAAATTGGACAAGCGACTATTTTCACCAAGATTGATCTCAAGAGCGGTTACCATCAAATTCGTATTAACCCGGGTGACGAATGGAAGACAGCATTTAAAACCCG
AGAAGGACTTTTTGAATGGCTAGTAATGCCTTTTGGGTTGTCTAATGCTCCAAGTACATTCATGAGGGTCATTGAATCAAGCCTTGCGGCCTTTCATTGGCACGTTCGTAGTGGTCTATT
TCGATGACCTTCTCATTTTTAGCTCTTCGGCGGACGCACATGCTGATCATTTGCGTGAGGTTCTCCAAGTCTTGCGCAAAGAGAAACTGTTCGCGGGAAAACAAAAATGTGAGTTCGGTG
CTTCCGAAGTTTTATTCCTCGGTTATGTCATCTCAGACAAGGGTCTATCAGTTGATAAATCAAAGATCGAAGCAGTCCGGTCTTGGCCCACGCCACGTACAGTGACTGAAGTCCGGAGTT
TCCATGGTCTCGCATCTTTTTATCGCCGGTTCATAAGTCATTTTAGCTCTATAATGGCCCCCATAACAAGTTGTATGAAGACGGGTGCCTTCACTTGGACCAAAGAAGCAAACTCGTCGT
TTGAACTCATCAAGGAAAAGCTGACAACAGCTCCGATTTTAATACTACCAGATTTTGCAACCACCTTTGAACTCCATTGCGATGCTTCTAAACTCGGGATTGGAGCTGTCCTAAGTCAAC
ACGGACGTCCGGTAGCATACTATAGTAAAAAGCTTGCTGGAGCTAGAAGTCGCTATAGTACCTATGACATCGAATTCTACGCTATTGTTCAGGCCATTAAACATTGGAGGCACTACCTTG
TACATCGTGACTTTATTCTGTTTACCGATCATGATGCACTACGCCATCTAGATAGTCAAGCCAATGTCTCTGCCCGACATGCAACTTGGATAGCGTTCTTGCAACAATTCACTTTCTCAA
TCCGTCATCATTCCGGCAAGTTAAACCGTGTAGCCGATGCCTTGAGTAGACGTCACGGACTGTTAACAACAATGCATACTACGGTGCCTGGTTTTTCTACTTTCGCTGAGCTATACGAAT
CTGATCCTTTCTTTGCTCGTATCCTCTCCGATGTCGAGCAAAACCTCACTTCCGAATACACGTTGCAAGACGGCTTTCTCTTCAAAGGGCTGCGTATTTGTGTTCCTATGTGTAGTCTAA
AGTTACAAATAATTCGTGAGCTTCATTGTGAGGGTCACGTCGGCCGAGACCGCACCTTGCATTTGGTCACCACGTCGTACTTTTGGCCATCTCTACGAAAAGATGTAGAGCGCTTTGTGG
AAAGGTGTCGGGTTTGCCAACAGGGCAAGGGGAAAGCTTCCAATGCGGGACTTTATTTACCACTACCTATTCCTACACAACCATGGACGGATGTTAGCATGGATTTTATTTTGGGCCTCC
CACGTACCCAGCGTGGTCACGATTCCATTTTTGTGGTGGTGGATCGTTTTTCAAAAATGGCTCACTTCATTCCCTGCAAAAAGACTACGGATGCGGTGACGGTGGCTGTGCTTTTTTTCC
GGGAGATTTATCGACTTCATGGTCTTCCGTCTTCTATAGTTTCAGACCGAGATACACGTTTCTTAAGTCACTTTTGGAGATCTTTATGGAAGCTTCTCGGCACAAGTCTTGACATGAGCA
CGGCGTATCACCCACAAACGGATGGCCAAACAGAGGTCACCAACCGCTCATTGGGCAACTTGCTACGCTGTTTAGTGGGAGACAACATTAAAAGCTGGGATGGCAAGTTGTGTCAAGCGG
AGTTTGCTCACAACCACGCCCTTAACCGAAGTCTCGGTTTTTCTCCTTTCTGTGTGGTTTACGGCTTGGTTCCACGCGGGCCACTGGATTTGTCTACATTCCCGGATAAGGCTCGTTTTC
ACGGTCATGCTATTGATTTTGTTAGTGACTTGCAACTGGTTCATCAACAAGCTCGTGCGAATTTGGAGGTTTCCACGGCCAAATACAAGAGTGCCGCGGACACTAAGCGACGTGAAGTTT
TATTTGAGCCAGGAGACATGGTTTGGGTCATCCTCACTAAAGACCGTCTTCCACTCCGAGAGTATAACAAGCTGAAGTCCAAGAAGATTGGTCCCGTAGAGGTGCTTGAACGCATTAATT
CCAATGCGTACCGCGTTCGTCTACCATCTCACATGAACACGTCCAACGTCTTCAATGTGAAGCATCTCATTCCTTTCCACGGGGACAATGACGCGCCGGATTCGTGGCCGAATCCTCTCC
CACCTGGGGAGACCTGATGCAGCGCATCTTCACTACTTGTTGGGCCTCGTTAACGTATCTCGTGCCCATCAAGATATTCAGTTGTAACAAGATCATTTCCTTAGTTTTCGAGACATTATC
ACTTCGTTTACGTTTTGTTATCATAGGATATTCTTAATATCTTTTAGGATTAGGATTAGTTTTATTTGCTTTTATCTCACGACTCTATATAAAGAGATCGTCTTCTCTGTAATCAAATCA
TCTTTGGCTTTAAGAATTCATTTGAAAACCTAAAGAGCTTGCTTTATGCGAACCCTGAGAGGAGGACTCTCGCCTTTTGTTTCTCGATCTCAATTCATCATTGAGCTCGTTTATCTCTGT
TTCGTTGCAACCTTCACCATACTCTGTTTTGACTTCACTAAAACAGAGCCCCCTTCCACCTAACCTTGTTCTAAGCTTCCACTTCTAATCTCTCTTTAAATTGCTTCCGCTCCCTCTATC
AGTTGGTATCAGAGACAAAACGTTTCTGAAAAGTTGAAATCTCGACCATGCCACCAAAGAAAGACGACGAGATCGCCGCCGCAAATTGGGCTGAACTGCGAGCCGCCCTATCCACCCTCC
TTGCGTTGCAGGAGACGATGTAGTCCAACATTCAAACCACCATTCAAGCCTCGATACGTGAACTTGGAGAAACTCTGACTCAACACTTACAACCACGACAACAGGCCGGAGACCAAAGAA
ACGAGATCGCAGAAGTGAACCCGTTTGCTCCTGATGGCATGGTTGCCCTCTCTGGTGCTCACACCATTGGACGAGCCCAATGTGTTACATTTAGAAACCGTATCTACAACGAAAGTAACA
TCGACACCTCTTTCGCTATCTCAAGACGGAAGAGTTGTCCAGCCGCCAATGGCTCCAGAGACAACAAGGAAGCCAATCTTGACGTCCGCACTCCTGATAGGTTCGACCACAACTACTATA
AGCAACTTCTCAGCAATAAGGGTTTGCTTACGCCAGACCAAGTCCTCTTTAATAACGGTCCCACCGACTCGATCGTCGTATCCTACAGCCGGAGTGTCCGTTCCTTCTACCGCGATTTCG
TAACGGCGATGATAAAAATGGGCAACATCAGCCCACTCACCGGATTAGGCCTGGGCATTCGGTTTCGGTTCGGTTGCATTCGGTTTCGGTTAGTTTGGATATGGTAA

Retrieve as FASTA