Entry information : AlyPrx44-2
Entry ID 7510
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx44-2
Name AlyPrx44-2
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx44-2
start..stop
S start..stop
AlyPrx44-1 623 0 1..312 1..312
CrubPrx117 588 0 1..312 1..312
CagraPrx21 587 0 1..312 1..312
CrubPrx65 587 0 1..312 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6843565..6843765 201 N° 2 6842728..6843465 738  
complement(join(6842728..6843465,6843565..6843765))


exon

Literature and cross-references AlyPrx44-2
DNA ref. Phytozome 12:   scaffold_7 (6843765..6842728)
Protein sequence: AlyPrx44-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (292)
PWM (Da):   %s   33922.4 (31752.3)  
PI (pH):   %s   11.25 (11.26) Peptide Signal:   %s   cut: 21 range:21-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAITALFFLFCFVAPSALAQLRQGFYGRSCPRAESIVANVVASRFRRDRSITAAFLRMQFHDCFVRGCDASLLIDPRPGRPSEKSTGPNASVRGYEVIDEAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRYSVPTGRRDGLRSNPGDVNLPGPTIPVSASIQLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFRDRLADPAMDRSLNARLRNTCRAPNDPTVFLDQRTPFTVDNAIYGEIRRQRGILRIDQNLGLSGSTRGIVSSFASSNTLFRQRFAQAMVKMGTIRVLTGRSGEIRRNCRLFNNGR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, intron 1)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGCAATCACAGCTTTGTTTTTCCTTTTCTGTTTCGTTGCTCCCTCTGCTTTGGCGCAGCTCCGACAAGGGTTCTACGGCCGCTCATGCCCTCGAGCTGAATCTATCGTTGCTAAT
GTTGTTGCCAGCCGTTTCCGCCGTGACCGTTCCATCACTGCTGCATTTCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GTTCGTAAGCTTCTCCTTGCATGTGTGTATATGTATATC
GTAAACTAGTTATCATCTAGACATAACACTGATCAAGCAATGTTTTTAATGGTTGTGTAGGGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCTGGAAGGCCATCAGAGAAAAGCACT
GGACCAAACGCAAGCGTGAGAGGCTACGAGGTCATTGATGAGGCTAAGAGACAACTAGAGGCTGCATGTCCCCGAACTGTCTCATGCGCAGACATTGTAACTCTAGCCACAAGAGACTCG
GTCGCATTAGCCGGCGGTCCAAGATACTCAGTACCAACAGGTAGACGTGATGGATTAAGGTCAAACCCTGGTGATGTGAACTTACCCGGACCAACAATTCCGGTTAGCGCATCTATCCAA
TTGTTTGCAGCTCAAGGTATGAATACCAACGATATGGTTACACTTATTGGTGGTGGACACAGCGTTGGTGTTGCACATTGCAGTCTCTTCAGGGACAGGCTTGCCGACCCAGCAATGGAC
AGGTCATTGAATGCTAGGTTGAGGAACACATGTCGTGCCCCAAATGACCCGACAGTCTTTTTGGACCAAAGGACTCCATTTACTGTGGATAACGCAATCTATGGAGAGATCCGACGTCAA
AGAGGAATTCTAAGAATTGATCAAAACTTGGGTCTCTCTGGATCAACCCGTGGGATTGTGTCGAGTTTTGCATCAAGCAATACACTCTTCAGACAGAGATTTGCCCAAGCAATGGTGAAA
ATGGGCACCATTAGGGTTCTCACTGGACGGTCCGGAGAGATCAGGAGAAACTGCAGACTGTTCAACAACGGACGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGCAATCACAGCTTTGTTTTTCCTTTTCTGTTTCGTTGCTCCCTCTGCTTTGGCGCAGCTCCGACAAGGGTTCTACGGCCGCTCATGCCCTCGAGCTGAATCTATCGTTGCTAAT
GTTGTTGCCAGCCGTTTCCGCCGTGACCGTTCCATCACTGCTGCATTTCTTCGTATGCAGTTTCATGATTGCTTTGTCAGG
GGTTGTGATGCTTCCCTCTTGATCGACCCAAGACCTGGA
AGGCCATCAGAGAAAAGCACTGGACCAAACGCAAGCGTGAGAGGCTACGAGGTCATTGATGAGGCTAAGAGACAACTAGAGGCTGCATGTCCCCGAACTGTCTCATGCGCAGACATTGTA
ACTCTAGCCACAAGAGACTCGGTCGCATTAGCCGGCGGTCCAAGATACTCAGTACCAACAGGTAGACGTGATGGATTAAGGTCAAACCCTGGTGATGTGAACTTACCCGGACCAACAATT
CCGGTTAGCGCATCTATCCAATTGTTTGCAGCTCAAGGTATGAATACCAACGATATGGTTACACTTATTGGTGGTGGACACAGCGTTGGTGTTGCACATTGCAGTCTCTTCAGGGACAGG
CTTGCCGACCCAGCAATGGACAGGTCATTGAATGCTAGGTTGAGGAACACATGTCGTGCCCCAAATGACCCGACAGTCTTTTTGGACCAAAGGACTCCATTTACTGTGGATAACGCAATC
TATGGAGAGATCCGACGTCAAAGAGGAATTCTAAGAATTGATCAAAACTTGGGTCTCTCTGGATCAACCCGTGGGATTGTGTCGAGTTTTGCATCAAGCAATACACTCTTCAGACAGAGA
TTTGCCCAAGCAATGGTGAAAATGGGCACCATTAGGGTTCTCACTGGACGGTCCGGAGAGATCAGGAGAAACTGCAGACTGTTCAACAACGGACGTTGA

Retrieve as FASTA