Entry information : AlyAPx01
Entry ID 7516
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyAPx01
Name AlyAPx01
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx01
start..stop
S start..stop
AhalAPx02 517 0 1..250 1..250
AtAPx01 514 0 1..250 1..250
CagraAPx01 506 0 1..250 1..250
BstrAPx01 506 0 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2909897..2910015 119 N° 2 2910112..2910286 175 N° 3 2910425..2910490 66 N° 4 2910705..2910839 135
N° 5 2910928..2911007 80 N° 6 2911081..2911183 103 N° 7 2911263..2911321 59 N° 8 2911404..2911419 16
join(2909897..2910015,2910112..2910286,2910425..2910490,2910705..2910839,2910928 ..2911007,2911081..2911183,2911263..2911321,2911404..2911419)


exon

Literature and cross-references AlyAPx01
DNA ref. Phytozome 12:   scaffold_1 (2909897..2911419)
Protein sequence: AlyAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27472.76  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPTVSEDYKKAIEKCKRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGLHIALRLLDPIREQFPTISFADFHLAGVVAVEVTGGPEIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYADEDAFFADYAEAHMKLSELGFADA

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 1, 7 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAACCGTGAGCGAGGATTACAAGAAAGCTATTGAGAAGTGCAAGCGGAAGCTCAGAGGTTTGATCGCTGAGAAGAACTGTGCACCCATCATGGTCCGACTCGCG
TAAGTAACTAACTATATCAGCGTGTGGTTGGTTTCTTCTAAAGTATTTAGGATGTGCAACACTTATCATGGTTGATTTGTTTGGCTAAACTGCAGGTGGCATTCTGCTGGAACTTTCGAT
TGTCAATCGAGGACTGGAGGTCCATTCGGAACAATGAGGTTTGATGCTGAGCAAGCTCATGGAGCCAACAGTGGTCTCCACATTGCTCTTAGGTTGTTGGACCCCATCAGGGAGCAATTC
CCTACCATCTCTTTTGCTGATTTCCATCAG
GTACATGATCTTAGATTTTAAAAAGAACTATTTGGTTAACTGTCATCACTTTAGAAAAGAAAACAACCGCATCGTTGATTACTCCTGTGT
TTGGAATCTTACTCATGATGACCTTTTTCTGTGAAATTGATCATTCAGCTTGCTGGTGTTGTGGCCGTTGAAGTTACTGGTGGCCCTGAAATTCCTTTCCACCCTGGAAGAGAGGTTAGT
CATTGCTGTAGATTTGTTTGCCGCCTCTAAGGTTACCATGTACTCAATTTGGTCGAGAGAATGTGTTTTGCTTTCTTTGTAGAGATGGCTGATTGATAATGTAGCTGTTCTCTCAATACT
TGTAATACTGAAACACGAGATAGAATTTGAAGGAGGAAACACCGTGGGACTTGATTGTTCGTTTCTAACATGCATATCTTGCTTTCAGGACAAGCCCCAGCCACCTCCTGAGGGTCGTCT
TCCTGATGCTACCAAGGGTTGTGATCACTTGAGAGACGTCTTTGCTAAGCAGATGGGCTTGTCTGACAAGGACATTGTCGCTTTATCTGGTGCCCACACTCTG
GTTTGATTCTCTCCAAC
TGCTTAAACACTTAATTTTTTGCCCCAATCTTACAAATTTTGATGAATACTTGCAAAATATGAAACCGCAGGGAAGATGCCACAAGGATAGGTCTGGCTTCGAAGGTGCCTGGACTTCAA
ACCCTCTAATCTTCGACAACTCTTACTTCAA
GTGAGTATCCCAAGTTCCCTTGTAGGAAGATTCAATGGCTGATATGGTTATTAATAAAATTATATATGATCAGGGAACTCTTGAGCGGA
GAGAAGGAAGGCCTTCTTCAGCTTGTCTCTGACAAGGCGCTATTGGATGACCCTGTTTTCCGTCCTTTAGTCGAGAAATACGCTGCT
GTATGCATCCTTTCTCTTTTCCCTGTTCTTCAC
TTGGTAGAGAGAGAGAGCTCATGATTTCTTGTGACATTGTGAACAGGATGAAGATGCCTTTTTCGCTGATTATGCCGAGGCCCACATGAAGCTTTCTGAGCTTGGGTACTTCTCTTGAAT
CTATTAATCATTCGAAAGTAAATATTAATGTAGTCGTGTGATTTGAATTTGTATCTGTTGATTGCAGGTTTGCTGATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAACTACCCAACCGTGAGCGAGGATTACAAGAAAGCTATTGAGAAGTGCAAGCGGAAGCTCAGAGGTTTGATCGCTGAGAAGAACTGTGCACCCATCATGGTCCGACTCGCG
TGGCATTCTGCTGGAACTTTCGATTGTCAATCGAGGACTGGAGGTCCATTCGGAACAATGAGGTTTGATGCTGAGCAAGCTCATGGAGCCAACAGTGGTCTCCACATTGCTCTTAGGTTG
TTGGACCCCATCAGGGAGCAATTCCCTACCATCTCTTTTGCTGATTTCCATCAG
CTTGCTGGTGTTGTGGCCGTTGAAGTTACTGGTGGCCCTGAAATTCCTTTCCACCCTGGAAGAGAG
GACAAGCCCCAGCCACCTCCTGAGGGTCGTCTTCCTGATGCTACCAAGGGTTGTGATCACTTGAGAGACGTCTTTGCTAAGCAGATGGGCTTGTCTGACAAGGACATTGTCGCTTTATCT
GGTGCCCACACTCTG
GGAAGATGCCACAAGGATAGGTCTGGCTTCGAAGGTGCCTGGACTTCAAACCCTCTAATCTTCGACAACTCTTACTTCAAGGAACTCTTGAGCGGAGAGAAGGAA
GGCCTTCTTCAGCTTGTCTCTGACAAGGCGCTATTGGATGACCCTGTTTTCCGTCCTTTAGTCGAGAAATACGCTGCT
GATGAAGATGCCTTTTTCGCTGATTATGCCGAGGCCCACATG
AAGCTTTCTGAGCTTGG
GTTTGCTGATGCTTAA

Retrieve as FASTA