Entry information : AlyAPx04
Entry ID 7518
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2010-08-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyAPx04
Name AlyAPx04
Class Ascorbate peroxidase    [Orthogroup: APx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx04
start..stop
S start..stop
AhalAPx03 567 0 1..279 1..279
AtAPx04 559 0 1..279 1..279
CrubAPx04 543 0 1..279 1..279
CagraAPx04 544 0 1..279 44..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2077348..2077457 110 N° 2 2077140..2077264 125 N° 3 2076985..2077034 50 N° 4 2076825..2076890 66
N° 5 2076697..2076742 46 N° 6 2076535..2076617 83 N° 7 2076371..2076450 80 N° 8 2076181..2076283 103
N° 9 2075911..2076087 177  
complement(join(2075911..2076087,2076181..2076283,2076371..2076450,2076535..2076 617,2076697..2076742,2076825..2076890,2076985..2077034,2077140..2077264,2077348. .2077457))


exon

Literature and cross-references AlyAPx04
DNA ref. Phytozome 11:   scaffold_7 (2077457..2075911)
Protein sequence: AlyAPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   279
PWM (Da):   %s   30777 Transmb domain:   %s   o250-272i
PI (pH):   %s   9.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVNVDAEYLKEIEKTRRDLRALISSRNCAPIMLRLAWHDAGTYDAKKKTGGPNGSIRFKEELTRPHNKGLEKAVAFKEVKAKHPRVSYADLYLAGVVAVEVTGGPAIPFTPGRKDADSPDDGELPNPNEGASHLRTLFSRMGLSDRDIVALSGGHTGRAHKERSDFEGPWTQDPLKFDNSYFVELLKGETPGLLQLKTDKALLDDLKFHPFVKLYADEDMFFKAYAISHKKLSELGFNPPRRIPSAVTEQTLGIAVAAAVVIFTICYEASRRGK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGAACGTCGATGCAGAGTACCTCAAAGAGATAGAGAAGACTCGTAGAGACCTTCGAGCTCTCATCTCTTCCAGAAACTGTGCTCCCATTATGCTCCGTCTTGCGTAAGATCTT
TGCTCTCAGAATCATTCTTCGTCTTTATTTATTGTCTTAATCTTTCCAAATGCAAATTATTGTGTGCATATAGATGGCATGATGCAGGAACCTATGATGCCAAGAAGAAAACCGGAGGTC
CCAATGGATCAATCAGGTTCAAGGAAGAGCTAACCCGTCCACACAACAAGGGTTTGGAGAAGGCAGTCGCTTTTTGCA
GTGAGTTTATGATCAAACCTTTCCTCCGTTGCTACTACTCTT
CAGGACCTGACAATAAACGGTTGCTGTTTCCTTTGATGTCTAAATTTTGGTTTCTAATTTCAGAGGAAGTAAAGGCTAAGCATCCACGAGTCTCTTACGCAGACCTCTATCAGGTAAAAA
TTGTGTAATAGCATCTCTAAGCCATTAAACTCATAAGAACTTTCTTCCCCCTTGATTTAGCTTGACAAATTTTTGGTTTCATTTCAGCTCGCTGGAGTTGTTGCAGTGGAGGTTACTGGG
GGCCCTGCAATCCCATTTACACCAGGCCGTAAG
GTAGTTACACTTACCGCTAAAGCGTATGCGTTAAATATTAGTTGCTAAGTAAGTTTACTAATGTTGAGAAATATGGTATCAGGATGC
TGATTCCCCGGACGACGGAGAACTTCCAAATCCAAATGAAG
GTTACTCACGCAGCTTGTAGCTCCCACAACGGAATTCTATTTCACAAACTGACTCAGCCCTCCTTTTGGATTATTGCAG

GTGCCTCACATTTAAGAACTCTCTTCTCTCGTATGGGTCTATCGGATAGAGACATTGTGGCTCTCTCTGGAGGTCACACTTTG
GTACTATTACTAACTCTCCTTCAAAATATTCGCCAGT
CACTAAACATGCTCCAATACCCAACTTGGTTCCTACTTTGTATATAGGGGCGTGCACATAAGGAGAGGTCAGATTTCGAAGGTCCTTGGACACAAGATCCTCTCAAGTTTGATAACTCAT
ATTTCGT
GTAAGCCAACAACAAAATCACAGAGAGTCAAAGCGAGAGAGAGTGAGAGTTCCAAAACTTACATTTTCTGCTGATTGATTTTTTCAGAGAGCTTCTAAAAGGGGAAACTCCTG
GATTGCTACAACTGAAAACCGACAAGGCTCTACTTGATGATCTAAAGTTCCACCCTTTTGTTAAGCTGTATGCAAAG
GTAGATTAGCTTTCACACGATTATAAGAAACTTTTAGTTTGGA
TGATTCTCTGGTTTCATCAACACAAAAATGTATTATGATGTGTATGTCAGGACGAGGATATGTTCTTCAAAGCCTATGCAATTTCACACAAGAAACTCTCAGAACTAGGATTTAATCCGC
CAAGAAGAATTCCTTCAGCAGTGACGGAGCAGACGCTTGGAATCGCTGTTGCTGCAGCTGTGGTGATCTTTACCATATGCTACGAAGCAAGCAGAAGAGGCAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGTGAACGTCGATGCAGAGTACCTCAAAGAGATAGAGAAGACTCGTAGAGACCTTCGAGCTCTCATCTCTTCCAGAAACTGTGCTCCCATTATGCTCCGTCTTGCATGGCATGAT
GCAGGAACCTATGATGCCAAGAAGAAAACCGGAGGTCCCAATGGATCAATCAGGTTCAAGGAAGAGCTAACCCGTCCACACAACAAGGGTTTGGAGAAGGCAGTCGCTTTTTGCA
AGGAA
GTAAAGGCTAAGCATCCACGAGTCTCTTACGCAGACCTCTATCAG
CTCGCTGGAGTTGTTGCAGTGGAGGTTACTGGGGGCCCTGCAATCCCATTTACACCAGGCCGTAAGGATGCTGAT
TCCCCGGACGACGGAGAACTTCCAAATCCAAATGAAG
GTGCCTCACATTTAAGAACTCTCTTCTCTCGTATGGGTCTATCGGATAGAGACATTGTGGCTCTCTCTGGAGGTCACACTTTG
GGGCGTGCACATAAGGAGAGGTCAGATTTCGAAGGTCCTTGGACACAAGATCCTCTCAAGTTTGATAACTCATATTTCGTAGAGCTTCTAAAAGGGGAAACTCCTGGATTGCTACAACTG
AAAACCGACAAGGCTCTACTTGATGATCTAAAGTTCCACCCTTTTGTTAAGCTGTATGCAAAG
GACGAGGATATGTTCTTCAAAGCCTATGCAATTTCACACAAGAAACTCTCAGAACTA
GGATTTAATCCGCCAAGAAGAATTCCTTCAGCAGTGACGGAGCAGACGCTTGGAATCGCTGTTGCTGCAGCTGTGGTGATCTTTACCATATGCTACGAAGCAAGCAGAAGAGGCAAGTGA

Retrieve as FASTA