Entry information : ZmPrx56
Entry ID 752
Creation 2005-12-13 (Christophe Dunand)
Last sequence changes 2005-12-13 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx56
Name ZmPrx56
Class Class III peroxidase    [Orthogroup: Prx082]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx56
start..stop
S start..stop
SbPrx49 541 0 1..323 1..323
SiPrx127 530 0 27..323 24..321
OsPrx115 493 8e-178 27..323 23..321
BdiPrx04 459 4e-164 11..322 6..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 172825140..172825358 219 N° 2 172824801..172824995 195 N° 3 172823921..172824481 561  
complement(join(172823921..172824481,172824801..172824995,172825140..172825358))


exon

Literature and cross-references ZmPrx56
Literature Qiu,F. et al., unpublished
DNA ref. GenBank:   AC211735.1 (36905..38339)
EST ref. GenBank:   BG874171   FL413084.1 [5' end]
Protein sequence: ZmPrx56
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   34451.76 (32016.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.14 (4.10) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSRMGLSVYLAIMAAVLASALGAELTADYYSETCPQALTTIKLLVGAAILREPRMGASLVRLHFHDCFVNGCDGSILLDDTDDMVGEKTAKPNNNSVRGYDVIDTIKSAVNTICLGNVVSCADILAVAARDSIVALGGTSYDVLLGRRDATTASMDDANNDIPTPFMDLPALQDSFESHGLSLHDLVVLSGGHTLGYSRCLFFRGRLYNETGTLDPAYAGSLDERCPLTGDDDALSALDDTPTTVDADYYQGLMQGRALLHSDQQLYQAGGAAGDLVEYYAENPTKFWEDFGAAMLKLGSLSPLTADEGEVRENCRVVNQV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, introns 1 and 2) and 2 ESTs. Contig contains 3 peroxidases: ZmPrx06, 42 and 56. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCGTCGCGAATGGGCTTATCCGTCTACCTCGCCATCATGGCGGCGGTGCTCGCCTCGGCGCTCGGAGCGGAGCTCACCGCGGACTACTATAGCGAGACGTGCCCGCAAGCG
CTGACCACCATCAAGCTCCTCGTCGGCGCCGCCATCCTGAGGGAGCCCAGGATGGGGGCGTCGCTGGTCCGCCTCCACTTCCACGATTGCTTCGTCAAT
GTGAGCGAGCGAGACGAGCTA
CCTAGCTGGCCATGCATACATAGCTTCTTGTACCTAGCTAGCTAATCAAGCCACCCCGCCGCCGCCACCGCGCCATGCATGCCAGTCATATAAACTGTAACTGTAACCTATACTACGTTG
CAGGGCTGCGACGGCTCCATCCTGCTGGACGACACCGACGACATGGTCGGCGAGAAGACGGCGAAGCCTAACAACAACTCCGTGAGAGGCTACGATGTCATAGACACCATCAAGTCGGCG
GTGAACACGATATGCTTGGGCAACGTCGTCTCCTGCGCCGATATCTTGGCCGTGGCCGCTCGCGATTCCATTGTCGCT
GTAAGTATAGTTCACCTGCTGGCCACTCACGCACTCACGGCT
CAAATGATTGCCTGCCCTACAAAAAAGGTCACGGAACCGCACTACTAAAACCGTGCAATAAGCAAGCGATACGTAGCATAAAGCACTAGCCAAAATCTTCTTCTCCAGGTCCAGCAGGCA
ACTTGCAAAAACCCTTTAAACCAAAAATCTTCACACTCCAAAGTCCAAAGTGACACCACTGACAGCAGTATGACGACTGACGTGACCCAAAGTTCACATATAAATTATTATTTTTTGTCT
GTCCATTGCGCGCGCGCGCGTATGGCGCTGCTTCCAGCTGGGAGGAACCTCGTACGACGTGCTCCTGGGGCGGCGCGACGCGACGACGGCAAGCATGGACGACGCGAACAACGACATCCC
GACGCCGTTCATGGACCTGCCGGCGCTGCAGGACAGCTTCGAGTCCCACGGCCTGTCCCTGCACGACCTGGTGGTGCTCTCCGGCGGCCACACGCTGGGCTACTCCCGCTGCCTCTTCTT
CCGCGGCCGCCTGTACAACGAGACCGGCACGCTGGACCCGGCGTACGCCGGGTCGCTGGACGAGCGCTGCCCGCTGACGGGCGACGACGACGCGCTGTCGGCGCTGGACGACACCCCCAC
CACCGTCGACGCGGACTACTACCAGGGCCTCATGCAGGGCCGCGCGCTGCTGCACTCGGACCAGCAGCTTTACCAGGCAGGCGGCGCCGCTGGCGATCTGGTGGAGTACTACGCCGAGAA
CCCGACCAAGTTCTGGGAGGACTTCGGCGCGGCCATGCTCAAGCTGGGCAGCCTGAGCCCGCTCACCGCCGACGAAGGGGAGGTCAGGGAGAACTGCCGGGTCGTCAACCAGGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCTTCGTCGCGAATGGGCTTATCCGTCTACCTCGCCATCATGGCGGCGGTGCTCGCCTCGGCGCTCGGAGCGGAGCTCACCGCGGACTACTATAGCGAGACGTGCCCGCAAGCG
CTGACCACCATCAAGCTCCTCGTCGGCGCCGCCATCCTGAGGGAGCCCAGGATGGGGGCGTCGCTGGTCCGCCTCCACTTCCACGATTGCTTCGTCAAT
GGCTGCGACGGCTCCATCCTG
CTGGACGACACCGACGACATGGTCGGCGAGAAGACGGCGAAGCCTAACAACAACTCCGTGAGAGGCTACGATGTCATAGACACCATCAAGTCGGCGGTGAACACGATATGCTTGGGCAAC
GTCGTCTCCTGCGCCGATATCTTGGCCGTGGCCGCTCGCGATTCCATTGTCGCT
CTGGGAGGAACCTCGTACGACGTGCTCCTGGGGCGGCGCGACGCGACGACGGCAAGCATGGACGAC
GCGAACAACGACATCCCGACGCCGTTCATGGACCTGCCGGCGCTGCAGGACAGCTTCGAGTCCCACGGCCTGTCCCTGCACGACCTGGTGGTGCTCTCCGGCGGCCACACGCTGGGCTAC
TCCCGCTGCCTCTTCTTCCGCGGCCGCCTGTACAACGAGACCGGCACGCTGGACCCGGCGTACGCCGGGTCGCTGGACGAGCGCTGCCCGCTGACGGGCGACGACGACGCGCTGTCGGCG
CTGGACGACACCCCCACCACCGTCGACGCGGACTACTACCAGGGCCTCATGCAGGGCCGCGCGCTGCTGCACTCGGACCAGCAGCTTTACCAGGCAGGCGGCGCCGCTGGCGATCTGGTG
GAGTACTACGCCGAGAACCCGACCAAGTTCTGGGAGGACTTCGGCGCGGCCATGCTCAAGCTGGGCAGCCTGAGCCCGCTCACCGCCGACGAAGGGGAGGTCAGGGAGAACTGCCGGGTC
GTCAACCAGGTGTGA

Retrieve as FASTA