Entry information : AlyAPx[P]01-2
Entry ID 7522
Creation 2010-08-10 (Christophe Dunand)
Last sequence changes 2011-01-28 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-01-28 (Christophe Dunand)
Peroxidase information: AlyAPx[P]01-2
Name AlyAPx[P]01-2
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx[P]01-2
start..stop
S start..stop
AhalAPx02 189 4e-62 1..119 41..163
AtAPx01 189 4e-62 1..119 41..163
AlyAPx01 188 8e-62 1..119 41..163
TparAPx01 184 3e-60 1..119 41..163
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12899791..12899951 161 N° 2 12900059..12900110 52 N° 3 12900248..12900402 155  
join(12899791..12899951,12900059..12900110,12900248..12900402)


exon

Literature and cross-references AlyAPx[P]01-2
DNA ref. Phytozome 12:   scaffold_4 (12899791..12900402)
Protein sequence: AlyAPx[P]01-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   127
PWM (Da):   %s   13085.65  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WHFAGTFDCQSRTEGPIGTMRFDAXXXXXXANSGIHIALRLLDLIRDQFPTISFADFHQLAGVVAVEVTGGPGREVRHPQPPREGRLPDATKGFDHLSDVFAKQMGLSDKDIVVLSGAHISISPFQS

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 4).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCACTTTGCTGGAACTTTCGATTGTCAGTCAAGGACTGAAGGTCCAATTGGAACAATGAGGTTTGATGCTGANNNNNNNNNNNNNNNNGCCAACAGTGGTATCCACATTGCTCTTAGG
TTGTTGGATCTCATCAGGGATCAATTCCCTACTATCTCTTT
TGCTGATTTCCATCAGTTACATGATTTTAGATTTTTTAAAAGCACTCTTTGGTTGACGGTGATAACTTTAGGGTTTGGA
TTCTAACTCTCGATGTCCTTTTGGTGTAAAAATTGATCTTTCATCTTGCTGGTGTTGTGGCCGTTGAAGTTACCGGTGGCCCTGGAAGAGAGGTTAATCATTGCTGAGAGAAAGTGTTCT
GCTTTCTTTGTAGAGATGGCTGATTGATAATGTAGACATTCTCTCAATACTTGTAATACTGAAACACTGTGGGACTTGATTGTCTGTTTCTAACATGCATATCTTGCTTTCAGGACATCC
CCAGCCACCTCGAGAGGGTCGTCTTCCTGATGCTACAAAGGGTTTTGATCACTTGAGTGATGTATTTGCTAAGCAGATGGGCTTGTCTGACAAGGACATTGTCGTTTTATCTGGTGCCCA
CATTTCTATTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCACTTTGCTGGAACTTTCGATTGTCAGTCAAGGACTGAAGGTCCAATTGGAACAATGAGGTTTGATGCTGANNNNNNNNNNNNNNNNGCCAACAGTGGTATCCACATTGCTCTTAGG
TTGTTGGATCTCATCAGGGATCAATTCCCTACTATCTCTTT
AAAATTGATCTTTCATCTTGCTGGTGTTGTGGCCGTTGAAGTTACCGGTGGCCATATCTTGCTTTCAGGACATCCCCAG
CCACCTCGAGAGGGTCGTCTTCCTGATGCTACAAAGGGTTTTGATCACTTGAGTGATGTATTTGCTAAGCAGATGGGCTTGTCTGACAAGGACATTGTCGTTTTATCTGGTGCCCACATT
TCTATTTC

Retrieve as FASTA