Entry information : AlyAPx23
Entry ID 7523
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyAPx23
Name AlyAPx23
Class Ascorbate peroxidase     [Orthogroup: APx018]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx23
start..stop
S start..stop
CrubAPx03-3 532 0 1..292 1..292
AlyAPx23-2 488 1e-176 2..292 4..292
CrubAPx03-2 470 1e-169 2..292 3..290
TsAPx23-2 468 9e-169 1..292 1..288
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21411683..21411795 113 N° 2 21411421..21411545 125 N° 3 21410945..21410994 50 N° 4 21410150..21410215 66
N° 5 21410015..21410063 49 N° 6 21409762..21409844 83 N° 7 21409593..21409672 80 N° 8 21409390..21409495 106
N° 9 21409102..21409308 207  
complement(join(21409102..21409308,21409390..21409495,21409593..21409672,2140976 2..21409844,21410015..21410063,21410150..21410215,21410945..21410994,21411421..2 1411545,21411683..21411795))


exon

Literature and cross-references AlyAPx23
DNA ref. Phytozome 11:   scaffold_3 (21411795..21409102)
Protein sequence: AlyAPx23
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292
PWM (Da):   %s   32434.53  
PI (pH):   %s   5.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAELVVDEVYLKEIDKARRELRALISQKNCAPIMLRLAWHDAGTYDVKSKTGGPNGSIRTEEEYSHGANSGLKIAIDLEEVKAKHPKITYGDLYLAGVVAVEITGGPDISFVPGRKDSNACTEEGRLPDANQGFKHLKDVFYRMGLSDKDIVALSGAHTGRAHLERSGFDGPWTRDPLKFDNSYFVELLKGEESEGLLKLSTDETLLDVPAFRRYVELYADEDAFFRDYAESHKKLSELGFTTPTDSVTKEETQWIITMELKLSKLGVAVVAAVVAFSCFSEIHKRMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGAACTCGTGGTTGATGAGGTTTACCTTAAGGAGATCGACAAGGCTCGCCGTGAGCTCCGTGCTCTCATCTCTCAGAAGAATTGCGCTCCGATCATGCTCCGATTGGCGTAAGTT
TCCATTTCCCTCATCATTTTTTTCCGATTCCGTCATATTTGAGTGCTACGAACTTGAGAAACCTTGCGATGCTGTTGAATATTGTTCACTGAGTCTGCGATTTCATGTTGTGTTATCTGG
TTTTGTGAAGGTGGCATGATGCTGGAACTTATGATGTCAAATCGAAGACTGGTGGACCTAATGGCTCGATTAGGACCGAAGAAGAGTACAGTCATGGTGCTAACAGTGGTTTGAAGATCG
CTATCGATCTCTGTG
GTACGTTTTTTCGTTTTCCTTATGGATTAGGTTGTGGTTGAGATTCAGTGACTAATTGAGTTCATCGTTCTAGGGATTGATTACGTTTCTTAACTTATCTATTGC
AGTCTTTGCTTACACTCAATTTATCACATTTTGAACCTGGCTTTTGAAATCGTTTTGTATATAGATGATTATTGTTTTGACAATGTTTTACCTGGAATATACAGATTTACTTGTAATGAG
CTTGTTCTACTAGTAGTCCTGAGGATTTATGAGAAGTTGACATGTTAAATTTGTTACTGTGTGTCTGATATACTCGTTAATTTTAGAAACTTTGACCTTGTACTCATGTGGGGTATCATT
TTGGCTAGTCACTTGAGAAATTTTTTGGAAACAATCTTACTTTTTCTTTTGAATTTGATGGTGATTATTTGATATTTTCAGAGGAAGTGAAAGCTAAACATCCCAAAATCACTTATGGGG
ACCTATACCAG
GTAACTAAAACAAAAACTGCATAAATGTCCCTACTGGATTTAACTCTGTAAACAAAGATCAGTATAAGATCACTTTTGTTTAGTTGTGTTGGTAGTATAATTTTCCTTC
GCCTTGTTATTTGTTCTCTTTCTTTAGAATTCTCTGGAAATTTTTATCCGCTGTGTATCAGAAACTCATCAGAAGTGTTAGTTTACTAGATATATTCGACTGAGTTGGGTGGTTGCAGTC
CTCATCAGGGTGTAGTTAAAAGGGAATTGAAGTTGTGCTTCCGGGTTGTAATATTTGGCTGATTTGCAGTGTGAAGATTCTTCACATAGATTAATACTACTGGTGTCTTTGGTGTTCTTT
GGCTTTCACAATTGTATTGTCATGTAAATAATATTGAAACAGTGTCACAATTATGGAGGAGATTTTAAAAAACATTAAAACCATTCACATCACGAAAGACCAGAAAAGAGAAAAATGACA
CTTGATCGTTGACTGTGAATTTGTGAAACATTTCATGAATCTGGTAGTTTCAATAAGGCTGCATAAACATTTCAATTGGTTACCTTAAACTATACTCATCAGTGTTGTTCTATTTAGCCC
TGGATTATATGAAGCTTACATAGTTGAGCTTTTGCACATCAAGGTTTAGTAGCTGCTAGTTAGGGATGCTATTATCTTATAGCAAGCATGTTTTGAATCTGAGTCGTTTTCAATCAATAA
ATGGTTCTGTCATTTTTCAGCTTGCGGGTGTTGTAGCGGTTGAAATTACTGGTGGACCTGACATCAGTTTTGTTCCTGGAAGAAAAGTAATATTCTATCAGCCTTTAAGATGTTATAACA
GCTTACTTTCAAAAGCATTTAACTAAATTAGCTGTATGTTTCTCTCTTATAGGATTCAAATGCCTGCACCGAAGAAGGAAGACTTCCTGATGCTAATCAAGGTTGGATGAAATCTTTTTC
CATTAATCACAAGCTCCAATATGTATTTTACAAACTAAAATACTAAAATTTGTATTTGAGTAGCAAATGAACTATGTGCAATGTAATCTTCCTTTTGAATGTACTCTTTCCTGAATGAGG
ATTTGAAGTTATGTCTGATCTTTGCATGTAGGTTTCAAACATCTTAAAGATGTCTTCTATCGGATGGGACTGTCTGATAAAGATATTGTGGCACTCTCAGGAGCTCATACTCTGGTACAT
TCTTTGTTGCAAATTTCAGATTTTTCGTTCGGTATAAAATAAATAAAGTGTGTATAGTGTTTTACTTAGATTTCGATGTTTAGGGAAGGGCTCATCTAGAGAGATCAGGTTTCGATGGAC
CATGGACTCGGGATCCTCTTAAGTTTGATAACTCATACTTTGT
GTAAGATCCTCATGTAAATTATTTTTTTTTGGATACAACAAATAGTTCTTCTGACTGAGTAGTAGATTGTTTATTCT
ATGATCTCTGTTGGTCCCAGGGAATTGCTGAAAGGAGAAGAATCAGAGGGCTTGCTGAAACTTTCGACGGACGAGACTTTGTTGGATGTACCAGCGTTCCGTCGTTATGTTGAGCTTTAC
GCAAAG
GTATTGTTCAAGGAAACGATTTGAACTATTAATCGTTTTGTTTCTTAACAAGTGTAAGTTTCTAACTTTTGTCCCTTACAGGACGAAGATGCATTCTTCAGAGACTATGCAGAA
TCACACAAGAAACTTTCAGAGCTCGGTTTCACTACACCAACTGATTCAGTCACTAAGGAGGAGACTCAGTGGATCATTACTATGGAACTAAAACTTTCAAAGCTTGGAGTCGCAGTCGTT
GCTGCTGTTGTGGCCTTTAGCTGCTTCAGTGAAATCCACAAAAGGATGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGAACTCGTGGTTGATGAGGTTTACCTTAAGGAGATCGACAAGGCTCGCCGTGAGCTCCGTGCTCTCATCTCTCAGAAGAATTGCGCTCCGATCATGCTCCGATTGGCGTGGCAT
GATGCTGGAACTTATGATGTCAAATCGAAGACTGGTGGACCTAATGGCTCGATTAGGACCGAAGAAGAGTACAGTCATGGTGCTAACAGTGGTTTGAAGATCGCTATCGATCTCTGTG
AG
GAAGTGAAAGCTAAACATCCCAAAATCACTTATGGGGACCTATACCAG
CTTGCGGGTGTTGTAGCGGTTGAAATTACTGGTGGACCTGACATCAGTTTTGTTCCTGGAAGAAAAGATTCA
AATGCCTGCACCGAAGAAGGAAGACTTCCTGATGCTAATCAAG
GTTTCAAACATCTTAAAGATGTCTTCTATCGGATGGGACTGTCTGATAAAGATATTGTGGCACTCTCAGGAGCTCAT
ACTCTG
GGAAGGGCTCATCTAGAGAGATCAGGTTTCGATGGACCATGGACTCGGGATCCTCTTAAGTTTGATAACTCATACTTTGTGGAATTGCTGAAAGGAGAAGAATCAGAGGGCTTG
CTGAAACTTTCGACGGACGAGACTTTGTTGGATGTACCAGCGTTCCGTCGTTATGTTGAGCTTTACGCAAAG
GACGAAGATGCATTCTTCAGAGACTATGCAGAATCACACAAGAAACTT
TCAGAGCTCGGTTTCACTACACCAACTGATTCAGTCACTAAGGAGGAGACTCAGTGGATCATTACTATGGAACTAAAACTTTCAAAGCTTGGAGTCGCAGTCGTTGCTGCTGTTGTGGCC
TTTAGCTGCTTCAGTGAAATCCACAAAAGGATGAAGTAA

Retrieve as FASTA