Entry information : AlyAPx23-2
Entry ID 7524
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyAPx23-2
Name AlyAPx23-2
Class Ascorbate peroxidase    [Orthogroup: APx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyAPx23-2
start..stop
S start..stop
CrubAPx03-2 540 0 3..292 2..290
TsAPx23-2 526 0 4..292 2..288
AhalAPx06 496 1e-180 36..292 1..257
BstrAPx03-2 497 3e-180 4..292 2..286
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21416465..21416583 119 N° 2 21416202..21416326 125 N° 3 21415784..21415833 50 N° 4 21415048..21415113 66
N° 5 21414909..21414957 49 N° 6 21414605..21414687 83 N° 7 21414441..21414520 80 N° 8 21414249..21414354 106
N° 9 21413915..21414115 201  
complement(join(21413915..21414115,21414249..21414354,21414441..21414520,2141460 5..21414687,21414909..21414957,21415048..21415113,21415784..21415833,21416202..2 1416326,21416465..21416583))


exon

Literature and cross-references AlyAPx23-2
DNA ref. Phytozome 12:   scaffold_3 (21416583..21413915)
Protein sequence: AlyAPx23-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292
PWM (Da):   %s   31969.19 Transmb domain:   %s   o263-285i
PI (pH):   %s   5.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATLVVDADYLKEIDKARRELRALIAKKNCAPIMLRLAWHDAGTYDAESKTGGPNGSIRNEAEYSHGANSGLKIALDLEEVKTKHPKISYADLYLAGVVAVEVTGGPDISFVPGRKDSNACTDEGRLPDANQGFKHLKDVFYRMGLSDKDIVALSGAHTGRAHPERSGFDGPWTQDPLKFDNSYFVELLKEEESEGLLKLATDKTLLEVPEFRQYVELYADEDAFFRDYAESHKKLSELGFTTPTSSVTKAITDNSTALAHSAVGVAVAAAVVAFGYFYEIRKRMK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 9 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGGCGACACTGGTGGTTGACGCGGATTACCTTAAAGAGATCGATAAAGCTCGCCGTGAACTCCGTGCACTCATCGCTAAGAAGAATTGCGCTCCGATCATGCTCCGATTAGCG
TAAGTTTCTATTTCTCTACTTTTTTTTCCGATTCCGTCATCGCGATGTTGTGGAAAATTGTTCGCTGCATTTACGATCGCTCGGTACTTTGATTTTGTTGACATGTTGTTGTTGTTGTCG
TCTTTGGTTTTGTGAAGGTGGCATGACGCTGGAACTTATGATGCTGAATCGAAGACAGGTGGACCTAATGGCTCGATTAGGAACGAAGCAGAGTACAGTCATGGTGCTAATAGTGGTTTG
AAGATCGCTCTTGATCTCTGTG
GTGCGTTTTTTCGTTTTCCTTCTCTGCTGTTATAGAGATTGTGTTTAGTAGCTTGATGAGACAATTCACATTTGGAACGTATTATTATATGGCTTTTG
AAATCTTGCTAAGTCTACATAATCGTTTTGTACATTGACCTTAAGATGAATAGATGATTATGTGTTGGGTCTTTACATGAATTGGGATCGTTCTTTTAGTAGTCCAGAGGATTTATGAGA
AGTTCACATGTTAAACTTTTTAGTCTATACACATGATCTTTTTTACTTTGTATTCATGTGGTGTATGAGTGTATCTTATGATTTACTAACAATTTTCATAACTATCTTACTTTTTCTTTT
GAACTTGATGGTGGTTCTTTGATATTTCAGAGGAAGTGAAAACTAAACATCCCAAAATCAGTTATGCAGACCTATACCAGGTAAGAATTTTGTAAACTCATCAGAAGGGCTAGTTTGTTT
GATAAATTCGGTGGAATTGTGCGTTTGTGGTCTTCAGGGTATAGAAACAGGGGAATTGAAAATTCTGCTTCAGAGTTGAAATATTTGGCTTATTTGCAGTAGGAAAATTCTTATCACAAA
TTAGAAATAATGGTCTAGTTTGTATTCTCTGGCTTTCGCAATGGTACTTCAAGTAAAATCTATTGATACAGTGTAAGAGTTATGGAAGAGTTTAACAAAACGTCTAATCCATTTCTGTGC
TAGGAGATGCACTCACGAAAGACCATAAAAAAAGCGCCACTTGATCATTGACTGTAATTTTTTGAAATTTTCCTGAATTTGGCTATGTCAGTAAGGCTACATTAACATTTCAGTTGGTTT
CCTTAAACTATTTACTCATCAATGGTGTTCTATTTAGCCCTGGAATTACTAGGTTTTAGATGTTTGTGCTTTTTACACCTATATCACATTTTCTAGTACTGTACATATCATGAATTGTAC
CACCGTTTTCTTCCTTAGGTATCATAATGTCAAGGCTTTAGCTGTGAATGCAAAAACAAATGTCCACAAGCAGGGCTGCTATTATATTATTGCAAGCAATTTGCAGATCATAGTCATATA
ATCACATGAAATTGATTCTGTCATTTTCAGCTTGCTGGTGTGGTAGCGGTTGAAGTTACTGGTGGACCTGACATCAGTTTTGTTCCTGGCCGAAAAGTAATGTTCTCTTAGCCATTAAGA
TGATTTGTATTGCAGCTTACTTCCAAAAGCAATTGACTATATTAGCTGTATGTTTCTCTCTTGTAGGATTCAAATGCCTGCACCGATGAAGGAAGACTTCCTGATGCTAATCAAGGTTGG
ATGAATTTTCTTTTCCATTTATCACAGAATCCAGAGTGTTTTACTGAAAATTAAACGTATGAACTTTGTATTTAAGTAGCAAACAAATAACGGAAGATGGTCGCATGGAATATTTGGAGG
GTCATGGTGTTTCCACGATGTACAACAAAATCTTCATTTTGGAATGTTATCTTCCTCAATGAGGGTTTAAACTTATGTCAGCTATTTTGCATGTAGGTTTCAAACATCTCAAAGATGTCT
TCTACCGGATGGGACTGTCTGATAAAGATATTGTGGCACTCTCAGGAGCTCATACTCTG
GTAAATTCTTTGATTGCTCAATTCACATTTGTTGTTTGTATTCAAAAGTTATGTATGGGGT
TTGAATTAGATTACAATATTTAGGGAAGGGCTCATCCAGAGAGATCAGGTTTTGATGGACCATGGACTCAAGATCCTTTAAAGTTTGATAACTCATACTTTGTGTAAGATCCCCTAAATC
CGTGGATATAGTTTTCTTTTATTGGAGACAACTACTTTTATTGATAAATCGTGATCACTGTTGGTACAGGGAACTGCTGAAAGAAGAAGAATCAGAGGGCTTACTGAAACTTGCAACGGA
CAAGACTTTGTTGGAAGTCCCCGAATTCCGTCAATACGTTGAGCTTTACGCAAAG
GTAATATTATGGGAGTCTATCCTTACTCTGATCCAAAGATCCGATTTAGTTTTTCACTCGCAAGC
TGCAAATCGAATACAAGCCAAGATAATGTTGCAAGTAGCATCTTGATTTCTTCTTTTGTCCCTTACAGGACGAAGATGCATTCTTCAGAGACTATGCAGAGTCACACAAGAAACTCTCAG
AGCTCGGGTTCACCACACCAACGTCTTCAGTCACTAAGGCAATAACAGACAACAGCACGGCGCTGGCACATAGTGCAGTCGGGGTTGCAGTCGCTGCTGCTGTGGTGGCCTTTGGCTACT
TCTATGAAATTCGAAAAAGGATGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGGCGACACTGGTGGTTGACGCGGATTACCTTAAAGAGATCGATAAAGCTCGCCGTGAACTCCGTGCACTCATCGCTAAGAAGAATTGCGCTCCGATCATGCTCCGATTAGCG
TGGCATGACGCTGGAACTTATGATGCTGAATCGAAGACAGGTGGACCTAATGGCTCGATTAGGAACGAAGCAGAGTACAGTCATGGTGCTAATAGTGGTTTGAAGATCGCTCTTGATCTC
TGTG
AGGAAGTGAAAACTAAACATCCCAAAATCAGTTATGCAGACCTATACCAGCTTGCTGGTGTGGTAGCGGTTGAAGTTACTGGTGGACCTGACATCAGTTTTGTTCCTGGCCGAAAA
GATTCAAATGCCTGCACCGATGAAGGAAGACTTCCTGATGCTAATCAAGGTTTCAAACATCTCAAAGATGTCTTCTACCGGATGGGACTGTCTGATAAAGATATTGTGGCACTCTCAGGA
GCTCATACTCTG
GGAAGGGCTCATCCAGAGAGATCAGGTTTTGATGGACCATGGACTCAAGATCCTTTAAAGTTTGATAACTCATACTTTGTGGAACTGCTGAAAGAAGAAGAATCAGAG
GGCTTACTGAAACTTGCAACGGACAAGACTTTGTTGGAAGTCCCCGAATTCCGTCAATACGTTGAGCTTTACGCAAAG
GACGAAGATGCATTCTTCAGAGACTATGCAGAGTCACACAAG
AAACTCTCAGAGCTCGGGTTCACCACACCAACGTCTTCAGTCACTAAGGCAATAACAGACAACAGCACGGCGCTGGCACATAGTGCAGTCGGGGTTGCAGTCGCTGCTGCTGTGGTGGCC
TTTGGCTACTTCTATGAAATTCGAAAAAGGATGAAGTAA

Retrieve as FASTA