Entry information : AlyPrx32
Entry ID 7530
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2011-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-27 (Christophe Dunand)
Peroxidase information: AlyPrx32
Name AlyPrx32
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx32
start..stop
S start..stop
AhalPrx29 713 0 1..352 1..352
AtPrx32 704 0 1..352 1..352
BstrPrx67 688 0 1..352 1..352
CrubPrx101 682 0 1..352 21..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7214756..7214983 228 N° 2 7213363..7213554 192 N° 3 7212693..7212861 169 N° 4 7212135..7212604 470
complement(join(7212135..7212604,7212693..7212861,7213363..7213554,7214756..7214 983))


exon

Literature and cross-references AlyPrx32
DNA ref. Phytozome 12:   scaffold_5 (7214983..7212135)
Protein sequence: AlyPrx32
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (323)
PWM (Da):   %s   38605.34 (35562.8)  
PI (pH):   %s   6.65 (6.50) Peptide Signal:   %s   cut: 30 range:30-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNFSYSSLSTLTTLITLGCLLLHSSNSSAQLTPTFYDNTCPNVFTIVRDTIVNELRSDPRIAASILRLHFHDCFVNGCDASILLDNTTSFQTEKDAAPNANSARGFPVIDRMKAAVETACPRTVSCADILTIAAQQSVNLAGGPSWRVPLGRRDSLQAFFALANANLPAPFFTLPQLKASFQNVGLNRPSDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLNTTYLQTLRGQCPRNGNQTVLVDFDFRTPTVFDNKYYVNLKELKGLIQTDQELFSSPNATDTVPLVREYADGTQKFFNAFVEAMNRMGNITPLTGTQGQIRQNCRVVNSNSLLHDVVEIVDFVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTTCTCTTATTCTTCTTTGTCAACTTTGACAACCCTAATAACATTGGGTTGTCTTCTGCTTCATTCATCCAATTCCAGTGCTCAGCTAACCCCAACCTTCTATGACAATACATGC
CCCAACGTCTTTACCATCGTACGGGACACCATCGTAAACGAGCTAAGATCAGATCCTCGTATCGCTGCAAGCATCCTTCGTCTTCACTTCCACGACTGCTTCGTCAAT
GTAATATAATTA
TTTTTCACCTTTTATTTTTTGGGTAAACAATTTGAAGTAAACTATTTTTTGTTTTGGTAACAGATTTGAAGTAAACTTTCGTTTGAAATATATATATATATATATATATATATATATGTA
TACGTTAGTATCTTTTATAATTACGTCCTTTAACAAAAAAAATAAAAACTTTTATAATTACATCAAAGACTTCCTTTTCCAATTTTCTGAAATATGTATATAACGGAATATATATTGTTC
ATGTATTTTCTAACTATTTGTTTTGTCAACTTACTCTAATTAACAGTTTGGATAGGCTTGTATTTATGATAATTGATTTCTGATAAATATGGGATAAAGGTGCTACTCAAGAAAAACCAG
TTACGTCTTTGTCAGTTTTAAATAACACATGGTTTGTTGATAACTACAAAACGAAAAGACGTGGTTTATGGCCTTCGTATATATAAATTATTCAAAGGTTTAGATGATTTTATTAATTAG
ACTAATATTTGTATATGTAGTATTAGTTACCATGATATGTTTGTTATCCACACTTATAGGTCACTGGGCTAATTAACGAATCTGGTTTCGAGATATATATCACATATACAATTTCCGGTA
GTTAGATGTGATATTTTTTTGGTTTTTACTGTCGAGTATCTTAGCTCTTGACCTCTTGTCGTCAAGATGACTATCATGATCACTTATTAAGAAAATGGTTCCACAACGTTTAGTAAGATT
TGATCTCCCATTCAACGAACGTAAATTATTCGTATAATAATTTAAGAAAAGCATGGACCCGTACCATACCAAACACGTTACGAATTTATATCAATCATTTATTAATGAAGGTTAGAAAAT
AACATATTTTCATATTATATAAATCGTTCAAAAGTTTATTTATTATTTCTGGGAAAGTTTCAACTCTCGAATCAGATGTAGTTGTTAACCTAATACATAATGTTGAATTTATGTGTTAGA
AGATTTATATAAAGTAAACTAAAATGAATACTAATTTGTTTATACTATATCATCACGCGTTACTTAAGAAGAACAAACCTTTTTAGTGAATGAAACTGCAAACTAACACTCTTTGTAGTT
ATAGTAAATATATCATTATGGAAAATACATATATATATATATATATATATCATTATGTTTATTAATATATGTTGACGAATTAGTGAACAAATAATTTTTGTTTGTAAAGGGCTGTGATGC
ATCGATTCTGTTAGACAACACAACATCCTTTCAAACTGAGAAAGACGCTGCTCCAAACGCAAACTCGGCTCGAGGATTTCCAGTGATTGATAGAATGAAAGCAGCAGTAGAGACAGCATG
TCCAAGGACTGTTTCATGCGCAGATATACTTACCATCGCAGCTCAACAATCTGTAAATCTG
GTATGCACCATTAAATTTATCTCTCTTTTTTCATTTATTACAAACATTGTCTCAAATTC
TTCTGTGAAGTCGTCACGGAACATGTTAAAACATGACAACATAGTATTGCAAATTTGCAATAAATAGATGGACTGCTGCAGCTTGGAAGTTATACCTTTTAGATTTAATTAATAGTATTG
AAAAAGGTTATCTACTATACCTGACATGTCTTTAAGATTCATTGTGAAAAATATTTAAAACGCATGGTAATAATATGAAGTCTCATTACAATTATAAATTTCATTACAATAAAAATATCA
AGTCTCCTATTTTGGTAACTATATAAAGAACATAATCATATTTTTCTAAAAAATTTAAAACCCATGCATAACTTTGAGAACCTAATTGTTGAATTTATATTATACATTTGTCTTTTTGGT
TTTGTTCATAGTAACTAACACTTCGACATGGTAAGATATACTTTCGTAAACAAATTATTATTTTTAAATATAAATGTTGTAGGCAGGAGGTCCTTCTTGGAGGGTTCCTTTGGGGAGAAG
AGATAGCTTACAAGCATTCTTTGCTCTCGCTAATGCAAATCTTCCCGCTCCATTTTTCACGCTCCCACAACTTAAGGCTAGCTTTCAAAATGTTGGACTTAACCGTCCCTCTGATCTCGT
TGCACTCTCTG
GTAATTATTATGAGATATAATAACAAGAATCTTCATGCTCTAATAAGTTTAAAAACTTTATTGTTAACTTATCTCTTATTTTGGTTAGGTGGTCACACATTTGGTAAAA
ACCAATGCCAATTTATTATGGATAGGCTATACAACTTTAGCAACACTGGTTTACCCGACCCTACTCTTAATACTACATACCTCCAGACACTTCGTGGACAATGTCCCCGGAATGGTAATC
AGACCGTCTTGGTCGATTTCGATTTTCGTACACCGACAGTTTTTGACAATAAATACTATGTGAATCTGAAAGAGCTAAAGGGACTTATCCAAACCGATCAAGAGTTGTTTTCCAGCCCTA
ATGCCACTGACACAGTCCCCTTGGTGAGAGAATATGCTGATGGCACTCAAAAATTCTTCAATGCTTTTGTTGAAGCCATGAATAGGATGGGAAACATTACACCTCTCACTGGAACTCAAG
GACAAATCAGACAGAATTGTAGGGTGGTCAACTCCAACTCGCTGCTACATGATGTGGTTGAAATTGTTGACTTTGTCAGCTCTATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTTCTCTTATTCTTCTTTGTCAACTTTGACAACCCTAATAACATTGGGTTGTCTTCTGCTTCATTCATCCAATTCCAGTGCTCAGCTAACCCCAACCTTCTATGACAATACATGC
CCCAACGTCTTTACCATCGTACGGGACACCATCGTAAACGAGCTAAGATCAGATCCTCGTATCGCTGCAAGCATCCTTCGTCTTCACTTCCACGACTGCTTCGTCAAT
GGCTGTGATGCA
TCGATTCTGTTAGACAACACAACATCCTTTCAAACTGAGAAAGACGCTGCTCCAAACGCAAACTCGGCTCGAGGATTTCCAGTGATTGATAGAATGAAAGCAGCAGTAGAGACAGCATGT
CCAAGGACTGTTTCATGCGCAGATATACTTACCATCGCAGCTCAACAATCTGTAAATCTG
GCAGGAGGTCCTTCTTGGAGGGTTCCTTTGGGGAGAAGAGATAGCTTACAAGCATTCTTT
GCTCTCGCTAATGCAAATCTTCCCGCTCCATTTTTCACGCTCCCACAACTTAAGGCTAGCTTTCAAAATGTTGGACTTAACCGTCCCTCTGATCTCGTTGCACTCTCTG
GTGGTCACACA
TTTGGTAAAAACCAATGCCAATTTATTATGGATAGGCTATACAACTTTAGCAACACTGGTTTACCCGACCCTACTCTTAATACTACATACCTCCAGACACTTCGTGGACAATGTCCCCGG
AATGGTAATCAGACCGTCTTGGTCGATTTCGATTTTCGTACACCGACAGTTTTTGACAATAAATACTATGTGAATCTGAAAGAGCTAAAGGGACTTATCCAAACCGATCAAGAGTTGTTT
TCCAGCCCTAATGCCACTGACACAGTCCCCTTGGTGAGAGAATATGCTGATGGCACTCAAAAATTCTTCAATGCTTTTGTTGAAGCCATGAATAGGATGGGAAACATTACACCTCTCACT
GGAACTCAAGGACAAATCAGACAGAATTGTAGGGTGGTCAACTCCAACTCGCTGCTACATGATGTGGTTGAAATTGTTGACTTTGTCAGCTCTATATGA

Retrieve as FASTA