Entry information : AlyPrx62
Entry ID 7536
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx62
Name AlyPrx62
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx62
start..stop
S start..stop
AtPrx62 603 0 1..318 1..319
BstrPrx31 585 0 1..318 1..318
CagraPrx25 575 0 1..318 1..318
CrubPrx82 575 0 1..318 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23102299..23102688 390 N° 2 23104115..23104277 163 N° 3 23104383..23104786 404  
join(23102299..23102688,23104115..23104277,23104383..23104786)


exon

Literature and cross-references AlyPrx62
DNA ref. Phytozome 12:   scaffold_7 (23102299..23104786)
Protein sequence: AlyPrx62
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (296)
PWM (Da):   %s   34019.89 (31553.6) Transmb domain:   %s   i2-24o
PI (pH):   %s   8.27 (8.22) Peptide Signal:   %s   cut: 23 range:23-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLVRFFCSFLVFLSCLIAVYGQGTRIGFYSTTCPNAETIVQTTVASHFGSDPKVAPGLLRMHNHDCFVQGCDGSVLLSGPNSERTAGANVNLRGFEVIDDAKRQLEAACPGVVSCADILALAARDSVALTNGQSWQVPTGRRDGRVSLASNVNNLPSPSDSLAIQQRKFGAFRLNTRDLVALVGGHTIGTAACGFITNRIFNSTGNTADPTMDQTFVPQLQRLCPQNGDGSARLDLDTGSGNTFDTSYFNNLSRNRGILQSDHVLWTSPTTRPIVQEFMTSTSNFNVQFASSMVKMSNIGVKTGRNGEIRRVCSAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, introns 2 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTGGTCCGATTCTTTTGTTCGTTCCTAGTCTTCCTTAGTTGTCTCATCGCGGTTTATGGTCAAGGTACAAGGATCGGGTTCTACTCGACCACATGCCCCAATGCCGAGACGATT
GTTCAGACCACTGTGGCATCTCACTTTGGTTCAGATCCAAAGGTTGCACCGGGGTTACTGAGAATGCACAACCATGATTGCTTTGTCCAAGGTTGTGATGGTTCAGTGCTTTTATCAGGA
CCTAACTCTGAAAGAACCGCTGGCGCAAACGTTAACCTTCGTGGTTTTGAGGTCATTGACGATGCCAAGAGGCAGCTCGAGGCGGCATGTCCTGGTGTTGTCTCTTGTGCTGATATCTTA
GCCTTGGCGGCTCGTGATTCCGTTGCTCTC
GTAAGTATACAAACTAATACAAATATCATACATAAGCAAATTAAAGAATTAATCTCGATTGTTTTAAATGCCAATATGTTGTGTTTGCAT
TTAGATATGAGTAAGAAAAGAGAATTAAAAAGGCAACACAATTTTTTTTTTTTTTTTTGTTTTATCATTATTTCTGTGTTTTGTGTTTACGTTTACAAATAAACTAGATTTTAACCCGCG
GTACACCGCGGGGCTATATTTTCTTAAAAAAATCAAAATGTAATTTGTTTGATAGATTATTTTGATTGTTAATTTTAGAATTTCACCCGTGGTATACTATCTTTTATAAATATCAACCCA
AACCCGTCCCATCATATTACCCGTCCCGTGAAATTAAACATCATTTAGTTATTTTTCTTTTTAATAATACTTTTATTTAAAAGCTATATAATTCAAGTCAATTTAAAAATTTCTTTTAAA
TGGTTCCCATAAGATATATATACATATATATTAAATTTGTATAGAGTTGAAATAATATTAATATTACAAACTTTTTATATAATTTAAATATTATAAATATTTTTAAAAATATGCAATATA
TATTTTTTGTTATTGAATAAGAGGATATTATGTGTAAGAAATGTAGAAAATAAGAGTTTAATATTTTTATTATGGAGTCGCAAGAAAAATCTTTTATTTCTATACATGTTATTCGTTTAT
TAATAATAAAAGAAAACAAATCCTTTAAATTAGATATTAACTAAAATAAACGCACCATAATTACTTATTAAGTAACAACCAATAAATTTCACCAAAAAATATGTAACAACCAATAAATTC
TAAAGGCAGTAATTAAAGAATGAGATATTAAAAAAAAATATCAAATAAGATATAAGAATCTTAAAATAATTGAATATCTAAATAATTTAATTGTTAGTGTCGATTTTAATGCCTTCATTA
ATGTGGATTTTTTTTTTTACAGAGAAATATTTCCTAAAGATTATCACATTAATGACTCAGAAAATTAAGGAAGATATGAATTTATGATTCTCGAAATCGTGTTGGTAATATCTTTAATTA
ATATTTTTCAAATTTAAATAATTAATGTCAATGGCATTCATCCGTAAATACATTCCAACTCCAGGATTTATTTGCTAAAAGTCATCCAAAAATGTATATATATATAGATTTTTTGGTTAA
ATTACTAAAAGTTGTTGTATATTTGTTGAAAGTAGTTACATCCTACATGTTACAAAACTTTGATATTAATTAAAAACATATATATAATTGAAAATAGAGATATTTTTTATATATATAATT
TTAGATTTAAAAAAATTTACATGCAACATTTAAGTTTATTTTACTTGGTGACATCTATAATATTAAATAAGTATTGGTTACAAAAAAAAGGTAATAACAAAAATAAGGATTAACGTTTTT
GTTTGGCTTTGTGTAGACGAACGGACAAAGTTGGCAAGTTCCAACAGGACGTAGAGATGGACGAGTTTCCTTGGCATCGAACGTTAACAATCTTCCTTCACCAAGTGACTCTCTAGCCAT
TCAACAAAGGAAATTCGGCGCTTTTCGCCTTAACACTCGCGATCTCGTCGCTCTTGTTG
GTAAGTAATCTATTAGAAATCAGAATAGTTCCAAATAGATTAGTGTTGTGCACTGCATCAT
GCATGGTTCATATAAATATAATCAAACTCGTATGAATTTAATAGGAGGACACACGATCGGAACAGCTGCATGTGGGTTTATCACGAACAGGATATTCAACTCGACCGGAAACACAGCCGA
TCCAACAATGGACCAAACATTTGTACCACAACTTCAAAGACTTTGTCCCCAAAACGGCGACGGATCAGCGCGTTTGGATCTTGATACGGGAAGTGGAAACACTTTTGACACATCTTATTT
CAACAATCTCAGCCGTAACAGAGGAATTCTTCAATCCGATCACGTTCTTTGGACTAGTCCTACCACGAGACCCATAGTGCAAGAGTTCATGACTTCTACAAGCAACTTTAATGTCCAGTT
CGCAAGTTCAATGGTTAAGATGAGTAATATTGGTGTGAAGACTGGGAGAAATGGAGAAATTCGTAGGGTTTGCTCTGCTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTGGTCCGATTCTTTTGTTCGTTCCTAGTCTTCCTTAGTTGTCTCATCGCGGTTTATGGTCAAGGTACAAGGATCGGGTTCTACTCGACCACATGCCCCAATGCCGAGACGATT
GTTCAGACCACTGTGGCATCTCACTTTGGTTCAGATCCAAAGGTTGCACCGGGGTTACTGAGAATGCACAACCATGATTGCTTTGTCCAAGGTTGTGATGGTTCAGTGCTTTTATCAGGA
CCTAACTCTGAAAGAACCGCTGGCGCAAACGTTAACCTTCGTGGTTTTGAGGTCATTGACGATGCCAAGAGGCAGCTCGAGGCGGCATGTCCTGGTGTTGTCTCTTGTGCTGATATCTTA
GCCTTGGCGGCTCGTGATTCCGTTGCTCTC
ACGAACGGACAAAGTTGGCAAGTTCCAACAGGACGTAGAGATGGACGAGTTTCCTTGGCATCGAACGTTAACAATCTTCCTTCACCAAGT
GACTCTCTAGCCATTCAACAAAGGAAATTCGGCGCTTTTCGCCTTAACACTCGCGATCTCGTCGCTCTTGTTG
GAGGACACACGATCGGAACAGCTGCATGTGGGTTTATCACGAACAGG
ATATTCAACTCGACCGGAAACACAGCCGATCCAACAATGGACCAAACATTTGTACCACAACTTCAAAGACTTTGTCCCCAAAACGGCGACGGATCAGCGCGTTTGGATCTTGATACGGGA
AGTGGAAACACTTTTGACACATCTTATTTCAACAATCTCAGCCGTAACAGAGGAATTCTTCAATCCGATCACGTTCTTTGGACTAGTCCTACCACGAGACCCATAGTGCAAGAGTTCATG
ACTTCTACAAGCAACTTTAATGTCCAGTTCGCAAGTTCAATGGTTAAGATGAGTAATATTGGTGTGAAGACTGGGAGAAATGGAGAAATTCGTAGGGTTTGCTCTGCTGTTAATTAA

Retrieve as FASTA