Entry information : ZmPrx58
Entry ID 754
Creation 2005-12-12 (Christophe Dunand)
Last sequence changes 2005-12-12 (Christophe Dunand)
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx58
Name ZmPrx58
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx58
start..stop
S start..stop
SofPrx14 613 0 2..351 6..358
ZmPrx24 575 0 26..351 26..357
SiPrx88 556 0 1..351 1..350
SbPrx97 541 0 8..350 13..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24818664..24818909 246 N° 2 24818369..24818554 186 N° 3 24817636..24818259 624  
complement(join(24817636..24818259,24818369..24818554,24818664..24818909))


exon

Literature and cross-references ZmPrx58
Literature Walbot,V., unpublished
Protein ref. UniProtKB:   B4FH68
DNA ref. GenBank:   CG139489 [5' end]   AC194215.3 (72244..73514) [3' end]
mRNA ref. GenBank:   BT036456
Cluster/Prediction ref. UniGene:   Zm.11803
Protein sequence: ZmPrx58
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (326)
PWM (Da):   %s   36909.54 (34604.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.35 (6.03) Peptide Signal:   %s   cut: 26 range:26-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSRVVAAAAVLVAFCAAALSSATVTVNEPIVNGLSWSFYDASCPSVEGIVRWHVADALRRDIGIAAGLIRIFFHDCFPQGCDASVLLSGSNSEQKQGPNQTLRPEALKLIDDIRAAVHAACGPKVSCADITTLATRDAVVASGGPFFEVPLGRRDGLSPASSDQVFTLPGPDFDVPTLLAAFKNRSLDTADLVALSGAHTVGRGHCSSFTSRLPPNADDGTMDPAFRRTLAAKCAKDASAAQVLDVRTPNAFDNKYYFDLIAKQGLFKSDQGLINDQTTKRAATRFALNQAAFFDQFARSMVKMSQMDVLTGNAGEVRLNCAVRNAARVVSADQLETAAGDEGLAADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, intron 1 and 2) and 6 ESTs (+BM380872). Contig contains 5 peroxidases ZmPrx 24, 47, 58, 81 and 85. Also found in Ac184771.4 (only exons 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCAGTAGTAGAGTAGTAGCAGCCGCCGCCGTCCTTGTAGCCTTTTGCGCCGCCGCCCTCTCGTCGGCCACGGTGACCGTGAACGAGCCCATCGTCAACGGCCTCTCCTGGAGC
TTCTACGACGCGTCCTGCCCGTCCGTCGAGGGCATCGTGCGCTGGCACGTCGCCGACGCCCTCCGCCGCGACATCGGCATCGCCGCCGGCCTCATCCGCATCTTCTTCCACGACTGCTTC
CCGCAG
GTACGTGCGTACGTGCATGACTGCATGTGTACGTCGTTCTTCGTTCGGTGATTATTGATGATGAGAATGAGATTGACACCGTACCAATCTATACTGTACATGCATATAGGGCTG
CGACGCGTCCGTCCTCCTGTCTGGTTCCAACAGCGAGCAGAAGCAGGGACCCAACCAGACGCTCCGTCCCGAGGCGCTCAAGCTCATCGACGACATCCGCGCCGCCGTCCACGCCGCCTG
CGGCCCCAAGGTGTCCTGCGCCGACATCACCACGCTCGCCACCCGGGACGCCGTCGTCGCG
GTAAGCACACGACGCCCATGCATCGCGGCAGGGACGTACACGTACATACGTCCCACGTA
CTATAATATAATTAACCAGCTGACAACACAACAAAACAATGCATATGCAGTCCGGGGGTCCCTTCTTCGAGGTGCCTCTCGGCCGCCGCGACGGGCTATCGCCGGCGTCCAGCGACCAGG
TCTTCACGCTGCCGGGCCCCGACTTCGACGTGCCCACGCTGCTCGCCGCGTTCAAGAACCGGAGCCTGGACACGGCGGACCTCGTGGCGCTCTCCGGGGCGCACACCGTGGGTCGTGGCC
ACTGCTCCTCCTTCACCAGCCGCCTCCCGCCCAACGCCGACGACGGCACCATGGACCCGGCGTTCCGCCGGACGCTCGCGGCCAAGTGCGCCAAGGACGCCAGCGCGGCGCAGGTGCTGG
ACGTGCGCACCCCCAACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGCTCTTCAAGTCGGACCAGGGCCTCATCAACGACCAGACCACCAAACGCGCCGCCACGC
GCTTCGCGCTCAACCAGGCCGCCTTCTTCGACCAGTTCGCCAGGTCCATGGTCAAGATGAGCCAGATGGACGTGCTCACGGGCAACGCCGGAGAGGTCCGCCTCAACTGCGCAGTGCGCA
ACGCCGCCCGCGTCGTCTCAGCAGACCAGCTCGAGACCGCCGCCGGCGACGAGGGGCTCGCGGCCGACGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCAGTAGTAGAGTAGTAGCAGCCGCCGCCGTCCTTGTAGCCTTTTGCGCCGCCGCCCTCTCGTCGGCCACGGTGACCGTGAACGAGCCCATCGTCAACGGCCTCTCCTGGAGC
TTCTACGACGCGTCCTGCCCGTCCGTCGAGGGCATCGTGCGCTGGCACGTCGCCGACGCCCTCCGCCGCGACATCGGCATCGCCGCCGGCCTCATCCGCATCTTCTTCCACGACTGCTTC
CCGCAG
GGCTGCGACGCGTCCGTCCTCCTGTCTGGTTCCAACAGCGAGCAGAAGCAGGGACCCAACCAGACGCTCCGTCCCGAGGCGCTCAAGCTCATCGACGACATCCGCGCCGCCGTC
CACGCCGCCTGCGGCCCCAAGGTGTCCTGCGCCGACATCACCACGCTCGCCACCCGGGACGCCGTCGTCGCG
TCCGGGGGTCCCTTCTTCGAGGTGCCTCTCGGCCGCCGCGACGGGCTA
TCGCCGGCGTCCAGCGACCAGGTCTTCACGCTGCCGGGCCCCGACTTCGACGTGCCCACGCTGCTCGCCGCGTTCAAGAACCGGAGCCTGGACACGGCGGACCTCGTGGCGCTCTCCGGG
GCGCACACCGTGGGTCGTGGCCACTGCTCCTCCTTCACCAGCCGCCTCCCGCCCAACGCCGACGACGGCACCATGGACCCGGCGTTCCGCCGGACGCTCGCGGCCAAGTGCGCCAAGGAC
GCCAGCGCGGCGCAGGTGCTGGACGTGCGCACCCCCAACGCCTTCGACAACAAGTACTACTTCGACCTCATCGCCAAGCAGGGGCTCTTCAAGTCGGACCAGGGCCTCATCAACGACCAG
ACCACCAAACGCGCCGCCACGCGCTTCGCGCTCAACCAGGCCGCCTTCTTCGACCAGTTCGCCAGGTCCATGGTCAAGATGAGCCAGATGGACGTGCTCACGGGCAACGCCGGAGAGGTC
CGCCTCAACTGCGCAGTGCGCAACGCCGCCCGCGTCGTCTCAGCAGACCAGCTCGAGACCGCCGCCGGCGACGAGGGGCTCGCGGCCGACGCGTGA

Retrieve as FASTA