Entry information : AlyPrx49 (AL7G14660)
Entry ID 7540
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-06 (Christophe Dunand)
Peroxidase information: AlyPrx49 (AL7G14660)
Name (synonym) AlyPrx49 (AL7G14660)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx49
start..stop
S start..stop
AalpPrx09 629 0 1..331 1..331
AhalPrx32 622 0 1..331 1..331
AruPrx49-2 618 0 1..331 1..331
AruPrx49-1 618 0 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1839787..1840011 225 N° 2 1840092..1840283 192 N° 3 1840361..1840526 166 N° 4 1840641..1841053 413
join(1839787..1840011,1840092..1840283,1840361..1840526,1840641..1841053)


exon

Literature and cross-references AlyPrx49 (AL7G14660)
DNA ref. Phytozome 12:   scaffold_7 (1839787..1841053)
Protein sequence: AlyPrx49 (AL7G14660)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36067.14 (33589.8)  
PI (pH):   %s   8.55 (8.49) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLKSFLLLLSLLCFVPLCLCDTSNGGKLCSGFYARSCPQAEEIVRSVVAKAVVRETRMAASLLRLHFHDCFVQGCDGSLLLDSSGRIVSEKNSNPNSRSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSVVTGGPSWVVPLGRRDSRSASLSGSNNNIPAPNNTFQTILSKFNRQGLDVTDLVALSGSHTIGFSRCTSFRQRLYNQSGNGRPDMTLEQSFAANLRQRCPRSGGDQILSVLDIISAAKFDNSYFKNLLENMGLLNSDQVLFSSNEKSRELVKKYAEDQGEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCAAGAGCTTTCTCCTTCTTCTTTCTCTCCTTTGCTTTGTCCCTCTCTGTCTCTGTGACACGAGCAATGGAGGCAAACTCTGCTCTGGCTTTTACGCCCGTTCATGCCCG
CAGGCCGAGGAGATCGTAAGATCAGTTGTAGCTAAAGCTGTTGTTAGAGAGACCCGTATGGCTGCTTCCTTATTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GTTTGGTTAAATTTT
TCAACGTTTCACCATTATTTGTTACTTTAAGTTTACTTGTTGAACAAGGTAACTGTGAAATGTAGGGTTGTGATGGCTCTTTGCTTCTAGACAGCAGTGGAAGGATAGTGAGTGAGAAAA
ACTCAAACCCTAACAGCAGATCGGCTCGTGGGTTCGACGTAGTTGACCAGATCAAAGCTGAATTGGAGAAACAATGCCCCGGAACTGTTTCTTGCGCTGATGTTCTTACCCTAGCCGCTA
GAGACTCCTCTGTTGTT
GTAAGTTGCCTCCATAATCTCTATTGTCTCAAACCAAAACTGAATCATCAGCTAACTCGATTTTGTTTTTGGTTTAGACCGGTGGACCAAGCTGGGTGGTTCC
ATTGGGAAGAAGAGATTCGAGAAGTGCAAGCTTGAGCGGTTCGAACAACAACATCCCTGCACCAAACAACACTTTCCAAACCATTCTATCGAAGTTTAACCGTCAAGGACTTGATGTCAC
TGACCTTGTTGCTCTTTCCG
GTAAGCTTTCGTCACTCCATCACAGTTGCATCACACACATGGAACACAATTAAAGAAACCCCATTATATGTTACTTGCTTCTCAAGCCACCACACTTGTC
AAATGTTTTCTCAGGTAGTCACACCATCGGATTCTCGAGATGCACGAGTTTCAGACAGAGGTTGTACAACCAGTCCGGAAACGGCCGTCCAGACATGACATTGGAACAGTCATTTGCTGC
TAACTTGCGCCAAAGGTGTCCGAGATCCGGTGGGGACCAGATTCTCTCGGTTTTGGACATCATCAGCGCCGCAAAATTCGACAACAGCTATTTCAAAAACTTGTTAGAGAATATGGGGCT
ATTGAATTCGGACCAAGTTTTGTTCAGCAGTAACGAGAAATCGAGAGAGCTAGTGAAAAAGTATGCAGAAGATCAAGGAGAGTTTTTTGAGCAATTTGCGGAATCGATGATCAAGATGGG
AAATATCTCTCCCTTGACAGGTTCGAGTGGCGAAATCAGGAAGAATTGCAGGAAGATAAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGACTCAAGAGCTTTCTCCTTCTTCTTTCTCTCCTTTGCTTTGTCCCTCTCTGTCTCTGTGACACGAGCAATGGAGGCAAACTCTGCTCTGGCTTTTACGCCCGTTCATGCCCG
CAGGCCGAGGAGATCGTAAGATCAGTTGTAGCTAAAGCTGTTGTTAGAGAGACCCGTATGGCTGCTTCCTTATTGAGACTTCATTTCCACGACTGTTTCGTTCAG
GGTTGTGATGGCTCT
TTGCTTCTAGACAGCAGTGGAAGGATAGTGAGTGAGAAAAACTCAAACCCTAACAGCAGATCGGCTCGTGGGTTCGACGTAGTTGACCAGATCAAAGCTGAATTGGAGAAACAATGCCCC
GGAACTGTTTCTTGCGCTGATGTTCTTACCCTAGCCGCTAGAGACTCCTCTGTTGTT
ACCGGTGGACCAAGCTGGGTGGTTCCATTGGGAAGAAGAGATTCGAGAAGTGCAAGCTTGAGC
GGTTCGAACAACAACATCCCTGCACCAAACAACACTTTCCAAACCATTCTATCGAAGTTTAACCGTCAAGGACTTGATGTCACTGACCTTGTTGCTCTTTCCG
GTAGTCACACCATCGGA
TTCTCGAGATGCACGAGTTTCAGACAGAGGTTGTACAACCAGTCCGGAAACGGCCGTCCAGACATGACATTGGAACAGTCATTTGCTGCTAACTTGCGCCAAAGGTGTCCGAGATCCGGT
GGGGACCAGATTCTCTCGGTTTTGGACATCATCAGCGCCGCAAAATTCGACAACAGCTATTTCAAAAACTTGTTAGAGAATATGGGGCTATTGAATTCGGACCAAGTTTTGTTCAGCAGT
AACGAGAAATCGAGAGAGCTAGTGAAAAAGTATGCAGAAGATCAAGGAGAGTTTTTTGAGCAATTTGCGGAATCGATGATCAAGATGGGAAATATCTCTCCCTTGACAGGTTCGAGTGGC
GAAATCAGGAAGAATTGCAGGAAGATAAACTCTTGA

Retrieve as FASTA