Entry information : AlyPrx58
Entry ID 7541
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx58
Name AlyPrx58
Class Class III peroxidase    [Orthogroup: Prx073]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx58
start..stop
S start..stop
AtPrx58 645 0 1..329 1..329
AhalPrx63 637 0 16..329 1..314
TsPrx58-1 619 0 1..329 1..330
BrPrx58-1Aa_other 615 0 1..329 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8398993..8399202 210 N° 2 8398270..8398467 198 N° 3 8397912..8398077 166 N° 4 8397363..8397778 416
complement(join(8397363..8397778,8397912..8398077,8398270..8398467,8398993..8399 202))


exon

Literature and cross-references AlyPrx58
DNA ref. Phytozome 12:   scaffold_6 (8399202..8397363)
Protein sequence: AlyPrx58
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (306)
PWM (Da):   %s   35389.8 (32943.4)  
PI (pH):   %s   4.91 (4.81) Peptide Signal:   %s   cut: 24 range:24-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSKTIPLIILSIFMFGVLSNAQLSSDFYSTTCPNVTAIARGLIERASRNDVRLTAKVMRLHFHDCFVNGCDGSVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGVVSCADILAIASEISVALAGGPSWDVLLGRRDGRTAIRADAVAALPLGPDSLEILTSKFSVHNLDTTDLVALSGAHTFGRVQCGVINNRLHNFSGNNGQSDPSIEPDFLQTLRRQCPQGGDLTARVNLDPTSPDSFDNDYFKNLQNNRGVIESDQILFSSTGAPTVALVNRFAESQNEFFRNFARSMIKMGNVRILTGSEGEIRRDCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTAAGCAAAACTATTCCCTTAATTATACTCTCGATTTTTATGTTTGGGGTTTTGAGTAACGCTCAGCTTAGTTCTGATTTTTATTCCACGACCTGCCCTAACGTCACAGCAATC
GCTCGGGGTCTGATCGAGAGAGCTAGCCGTAACGACGTCAGACTCACTGCTAAAGTCATGCGTCTTCACTTTCACGACTGTTTCGTGAAC
GTAAGATCTATTTTCTATTCATCTTGAATC
CAAACCAGCACATGTGAAAGTTTATGAATGAATCTAATTACTAAACATGACTTTACATGTTTGATTAGGCCACATTTATTTTTGTTTTGTACGTTTAAGGGGTATTAATAGTTCATACTC
GATCGTTGTTTGACCCAAAAAAGTACCTACTCGATCGTTGTAAAGGGTGATGGACATCAATCCAAGGAAAATTAAGTTTAGAGTTTGCATTAGTGGAGTCATTTTTCAAAGTCAAGTTTG
AAGTTTCTATTGATGTTTGATTACACATGTTTGACTATAGATTCTGTCATTAAGCTTGGTTTCATATTGAGAAAGTAACGGTCTTTCTTAAGCCAAGTTAAAATATCCCCTTTTTTTCCT
TCACTAATCTTTAACTAAGAAAAGTACATAGACTTTGTCAAGAAAACATAACTAGGTTTATTTTGTTAGTGGAATTAGGTTTCCTTTAAACTTTAGATATGCGTAAAATATTGAAGTCAT
AGTGTGTGAACACAGGGGTGCGATGGTTCGGTACTATTGGACGCTGCTCCTGCGGATGGGGTAGAGGGTGAAAAGGAGGCTTTCCAAAACGCGGGCTCTCTTGACGGATTTGAAGTGATC
GATGATATCAAAACCGCCCTCGAGAATGTTTGTCCGGGAGTTGTCTCTTGTGCCGATATCCTTGCTATCGCATCTGAAATCTCTGTTGCACTG
GTAATAACATAATTCTTGAAAATTATG
TGCTTTCAGATTCCCTTTTTTAACCAATGGATACATAACCATAACATAGACTCTGTTACCACTGCATTCAAATTTTCTAATACATGTTGAGAAAAATATTATGAAAACATTATAACATAC
CGAATACTCTAGTAATGTTTTGATTTGTTTATATCATTAATTAAGGCGGGAGGGCCGTCATGGGACGTATTGCTAGGAAGGAGAGATGGCAGGACGGCGATCCGTGCGGACGCAGTGGCT
GCACTTCCACTAGGTCCTGATTCTCTAGAGATTCTTACTTCCAAATTCTCCGTACACAATCTTGACACTACTGATCTCGTCGCTTTGTCTG
GTAATTCACTTTTGTATTTGGTCATCTCA
GAAACATGATTTAATAATTTATAGAGTAAAATTAGTAAATACTTCAATAGTACTTTGTCACGATATATCTTAAGGAAGTATGAATCGCAACAATGTATATACAGGTGCTCATACCTTCGG
GAGGGTCCAGTGTGGAGTGATAAACAATCGTCTGCACAACTTTAGTGGTAACAACGGACAGTCCGACCCGAGTATCGAACCTGACTTCTTACAAACATTGCGACGACAATGCCCGCAAGG
CGGAGATCTCACAGCGAGGGTGAATCTTGATCCTACGAGCCCCGACTCATTTGATAACGACTATTTCAAGAACCTTCAAAACAACCGCGGAGTGATTGAATCAGACCAAATCTTGTTCTC
TTCGACAGGAGCGCCTACTGTAGCTTTGGTGAATCGTTTTGCTGAGAGCCAAAACGAGTTCTTTAGAAATTTTGCAAGATCAATGATCAAGATGGGAAATGTAAGGATTCTCACAGGAAG
TGAGGGAGAGATTCGTAGAGACTGCAGACGGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTAAGCAAAACTATTCCCTTAATTATACTCTCGATTTTTATGTTTGGGGTTTTGAGTAACGCTCAGCTTAGTTCTGATTTTTATTCCACGACCTGCCCTAACGTCACAGCAATC
GCTCGGGGTCTGATCGAGAGAGCTAGCCGTAACGACGTCAGACTCACTGCTAAAGTCATGCGTCTTCACTTTCACGACTGTTTCGTGAAC
GGGTGCGATGGTTCGGTACTATTGGACGCT
GCTCCTGCGGATGGGGTAGAGGGTGAAAAGGAGGCTTTCCAAAACGCGGGCTCTCTTGACGGATTTGAAGTGATCGATGATATCAAAACCGCCCTCGAGAATGTTTGTCCGGGAGTTGTC
TCTTGTGCCGATATCCTTGCTATCGCATCTGAAATCTCTGTTGCACTG
GCGGGAGGGCCGTCATGGGACGTATTGCTAGGAAGGAGAGATGGCAGGACGGCGATCCGTGCGGACGCAGTG
GCTGCACTTCCACTAGGTCCTGATTCTCTAGAGATTCTTACTTCCAAATTCTCCGTACACAATCTTGACACTACTGATCTCGTCGCTTTGTCTG
GTGCTCATACCTTCGGGAGGGTCCAG
TGTGGAGTGATAAACAATCGTCTGCACAACTTTAGTGGTAACAACGGACAGTCCGACCCGAGTATCGAACCTGACTTCTTACAAACATTGCGACGACAATGCCCGCAAGGCGGAGATCTC
ACAGCGAGGGTGAATCTTGATCCTACGAGCCCCGACTCATTTGATAACGACTATTTCAAGAACCTTCAAAACAACCGCGGAGTGATTGAATCAGACCAAATCTTGTTCTCTTCGACAGGA
GCGCCTACTGTAGCTTTGGTGAATCGTTTTGCTGAGAGCCAAAACGAGTTCTTTAGAAATTTTGCAAGATCAATGATCAAGATGGGAAATGTAAGGATTCTCACAGGAAGTGAGGGAGAG
ATTCGTAGAGACTGCAGACGGGTCAATTAA

Retrieve as FASTA