Entry information : AlyPrx50
Entry ID 7543
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx50
Name AlyPrx50
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx50
start..stop
S start..stop
AhalPrx33 627 0 1..327 1..327
AtPrx50 622 0 1..327 3..329
CrubPrx73 620 0 22..327 25..330
BstrPrx06 619 0 21..327 23..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1252410..1252619 210 N° 2 1252119..1252319 201 N° 3 1251867..1252032 166 N° 4 1251303..1251709 407
complement(join(1251303..1251709,1251867..1252032,1252119..1252319,1252410..1252 619))


exon

Literature and cross-references AlyPrx50
DNA ref. Phytozome 12:   scaffold_7 (1252619..1251303)
Protein sequence: AlyPrx50
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35772.3 (33260.8)  
PI (pH):   %s   8.72 (8.56) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVIKTNLLLLLLSLFLTLNLSSAQLRRNFYAGICPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTDNNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPKYDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGTHTLGFAHCTKVFDRIYTFNKTTKVDPTVNKDYVTELKASCPQNVDPRVAINMDPTTPRQFDNVYYKNLQQGKGLFTSDQVLFTDRRSKPTVDLWASNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRDCGAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATCAAAACGAATCTCTTATTGCTTCTTCTCTCTCTCTTTCTCACCCTCAACCTCTCCTCCGCTCAACTCCGCCGCAACTTCTACGCCGGAATTTGTCCTAACGTCGAGCAAATC
GTTAGAAACGCCGTTCAGAAAAAAGTCCAACAAACTTTCACCACCATTCCCGCCACTCTCCGCCTCTATTTCCACGATTGTTTCGTCAAT
GTAATTAAAACATATTTTTTATTGATAGTT
TTGCGTAGAATTATTTCATTGTTTTGTCTAATTTATGGATTAATTGATTAATAATCATAGGGGTGTGATGCATCAGTGATGATAGCGTCGACTGATAATAATAAGGCGGAGAAGGATCAT
GAGGAGAATCTATCGTTGGCCGGAGATGGATTCGACACCGTCATTAAAGCTAAAGAAGCTCTTGACGCCGTCCCAAATTGTCGTAACAAAGTTTCTTGCGCTGATATTCTCACTATGGCC
ACTCGTGACGTCGTTAATCTT
GTTAGTAACTCATTCACATTTATATAATACAATGTTTTGTTAAATTAAAACATTATTGTTAAGTTATTAAATTAAATTCAATATAGGCGGGTGGACCAA
AATACGACGTGGAATTGGGAAGGCTAGATGGATTATCGTCAACGGCGGCTAGCGTCGGAGGGAAGTTGCCTCATCCGACCGACGATGTCAATAAACTCACTTCACTTTTCGCGAAAAACG
GCCTTAGCCTTAACGACATGATCGCTCTGTCCG
GTAAGAAGATTTGAAAGAATAGTATCATTCGGATAAAAACAAATTAGCTATATATAGTAGTGATTTCAATTTGGTAATATTTCGGTT
TAGCTTCATGTGGTTATCGGTTTATATTTCCGGTCCTAATTTACATTTGGTTTGATCTTAAACATCTCAGGGACACACACATTAGGATTCGCGCATTGCACAAAAGTATTCGATCGGATA
TACACTTTCAACAAGACAACTAAAGTGGATCCCACGGTTAACAAAGATTACGTGACAGAGCTAAAAGCGTCGTGTCCTCAAAACGTAGATCCAAGAGTGGCTATAAACATGGATCCAACA
ACACCAAGACAATTCGACAACGTTTACTACAAAAACTTGCAACAAGGGAAAGGACTGTTCACGTCTGATCAAGTCTTATTCACGGATCGTCGGTCAAAGCCAACCGTTGACTTGTGGGCA
AGTAATGGACAGTTGTTTAATCAAGCTTTTATTAACTCGATGATCAAGCTTGGTCGTGTTGGTGTTAAGACCGGTAGTAATGGTAATATCCGTCGTGATTGTGGAGCTTTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATCAAAACGAATCTCTTATTGCTTCTTCTCTCTCTCTTTCTCACCCTCAACCTCTCCTCCGCTCAACTCCGCCGCAACTTCTACGCCGGAATTTGTCCTAACGTCGAGCAAATC
GTTAGAAACGCCGTTCAGAAAAAAGTCCAACAAACTTTCACCACCATTCCCGCCACTCTCCGCCTCTATTTCCACGATTGTTTCGTCAAT
GGGTGTGATGCATCAGTGATGATAGCGTCG
ACTGATAATAATAAGGCGGAGAAGGATCATGAGGAGAATCTATCGTTGGCCGGAGATGGATTCGACACCGTCATTAAAGCTAAAGAAGCTCTTGACGCCGTCCCAAATTGTCGTAACAAA
GTTTCTTGCGCTGATATTCTCACTATGGCCACTCGTGACGTCGTTAATCTT
GCGGGTGGACCAAAATACGACGTGGAATTGGGAAGGCTAGATGGATTATCGTCAACGGCGGCTAGCGTC
GGAGGGAAGTTGCCTCATCCGACCGACGATGTCAATAAACTCACTTCACTTTTCGCGAAAAACGGCCTTAGCCTTAACGACATGATCGCTCTGTCCG
GGACACACACATTAGGATTCGCG
CATTGCACAAAAGTATTCGATCGGATATACACTTTCAACAAGACAACTAAAGTGGATCCCACGGTTAACAAAGATTACGTGACAGAGCTAAAAGCGTCGTGTCCTCAAAACGTAGATCCA
AGAGTGGCTATAAACATGGATCCAACAACACCAAGACAATTCGACAACGTTTACTACAAAAACTTGCAACAAGGGAAAGGACTGTTCACGTCTGATCAAGTCTTATTCACGGATCGTCGG
TCAAAGCCAACCGTTGACTTGTGGGCAAGTAATGGACAGTTGTTTAATCAAGCTTTTATTAACTCGATGATCAAGCTTGGTCGTGTTGGTGTTAAGACCGGTAGTAATGGTAATATCCGT
CGTGATTGTGGAGCTTTTAATTAA

Retrieve as FASTA