Entry information : AlyPrx39
Entry ID 7547
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx39
Name AlyPrx39
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx39
start..stop
S start..stop
AtPrx39 647 0 1..327 1..326
CrubPrx89 634 0 1..327 1..326
BstrPrx83 626 0 1..327 1..326
CagraPrx22 621 0 11..327 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21068692..21068904 213 N° 2 21069170..21069364 195 N° 3 21069447..21069609 163 N° 4 21069774..21070186 413
join(21068692..21068904,21069170..21069364,21069447..21069609,21069774..21070186 )


exon

Literature and cross-references AlyPrx39
DNA ref. Phytozome 11:   scaffold_6 (21068692..21070186)
Protein sequence: AlyPrx39
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (303)
PWM (Da):   %s   35692.94 (33040.5)  
PI (pH):   %s   7.74 (7.41) Peptide Signal:   %s   cut: 25 range:25-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKFGLALVMMILVIQGFVRFSEAQLKMGFYDQTCPYAEKIVQDVVNQHIHNAPSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRDGRISNFAEARNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSMDSEYVDNLKSRRCLALADNTTTVEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFSGGSEQEFFAEFSKSMEKMGRIGVKTGSDGEIRRTCAFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAATTCGGGTTGGCTCTTGTGATGATGATTCTTGTGATTCAAGGGTTTGTGAGATTTTCAGAAGCACAATTGAAGATGGGATTCTACGACCAAACTTGCCCTTACGCAGAGAAG
ATTGTCCAAGATGTTGTCAACCAACATATCCACAATGCACCCTCTTTGGCTGCTGGGCTTATTAGGATGCATTTTCATGATTGCTTCGTGCGG
GTATTCTTTTTCTCTTTTCTTTTTGTA
TCAAATTTATCGTATACTAGACTGATTATCATAAGCACACTTAATAAATATAGATTATACTACCCAAAAAAAACATTATGTGTTAGTATCATCAAAATATTACAGAGGCTTTAACAAAGA
AACAAAAAATTAATTCAGAGATATTACTTTAGCCATGCATTAAATCATATAGTATATGCGAAAACGTTTAGTTTTGTATATAGATAGCTATATTAATATGTATGCATGGTTTTGACAGGG
TTGCGATGGTTCGATCTTGATCAACGCGACATCGAGCAACCAACAAGTCGAGAAGCTTGCTCCTCCGAATCTAACTGTTAGAGGTTTCGATTTCATCGATAAAGTAAAGTCTGCTCTAGA
ATCAAAGTGTCCTGGAATCGTCTCCTGCGCTGATATCATTACCCTCGCTACTAGAGACTCTATTGTTGCAATT
GTGAGTATGCTAATACTTTAGTTAATTACCTCGTTTTGACCAATACA
CAAAAACTAACCAGTTTTGATTAATTGTGGCTTAGGGTGGACCGACATGGAATGTTCCAACGGGACGCAGAGACGGACGTATCTCTAACTTTGCCGAGGCTAGGAACAATATTCCACCTC
CTTTCGGAAACTTCACGACTCTTATAACCCTCTTTGGAAACCAAGGACTTGATGTTAAAGACCTTGTCTTGTTATCCG
GTAATATCCAACTCCAAATTGTCTTTTTTTTGTTCGGTTTAT
AAAATTTTGGTTGAGCTAAAACTCATAGAAGAAACAAAACACTGCGTTTTGATTTAATGGGTTATTTAAACGGTGTCGTTTTAATTTATGGTATTTAAACAGTGTCATTTTAAACGTTTT
AGGTGCGCACACTATTGGAGTGTCTCATTGCTCCTCCTTCTCAAACCGTCTCTTCAATTTTACCGGCGTTGGAGACCAAGATCCGTCAATGGACAGCGAATATGTCGACAATCTCAAGTC
ACGGAGATGTTTGGCTCTCGCCGACAATACCACAACGGTCGAAATGGATCCCGGTAGTCGAAACACCTTCGATCTTAGCTACTACCGTCTGGTGCTGAAACGTCGTGGACTTTTCGAGTC
TGACGCTGCATTGACTATGAATCCCGCGGCATTGGCTCAGGTCAAACGCTTTTCCGGAGGATCGGAGCAAGAGTTCTTTGCTGAGTTCTCGAAGTCCATGGAGAAAATGGGAAGGATTGG
GGTCAAAACCGGGTCGGATGGGGAGATCCGGAGAACATGTGCATTTGTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAATTCGGGTTGGCTCTTGTGATGATGATTCTTGTGATTCAAGGGTTTGTGAGATTTTCAGAAGCACAATTGAAGATGGGATTCTACGACCAAACTTGCCCTTACGCAGAGAAG
ATTGTCCAAGATGTTGTCAACCAACATATCCACAATGCACCCTCTTTGGCTGCTGGGCTTATTAGGATGCATTTTCATGATTGCTTCGTGCGG
GGTTGCGATGGTTCGATCTTGATCAAC
GCGACATCGAGCAACCAACAAGTCGAGAAGCTTGCTCCTCCGAATCTAACTGTTAGAGGTTTCGATTTCATCGATAAAGTAAAGTCTGCTCTAGAATCAAAGTGTCCTGGAATCGTCTCC
TGCGCTGATATCATTACCCTCGCTACTAGAGACTCTATTGTTGCAATT
GGTGGACCGACATGGAATGTTCCAACGGGACGCAGAGACGGACGTATCTCTAACTTTGCCGAGGCTAGGAAC
AATATTCCACCTCCTTTCGGAAACTTCACGACTCTTATAACCCTCTTTGGAAACCAAGGACTTGATGTTAAAGACCTTGTCTTGTTATCCG
GTGCGCACACTATTGGAGTGTCTCATTGC
TCCTCCTTCTCAAACCGTCTCTTCAATTTTACCGGCGTTGGAGACCAAGATCCGTCAATGGACAGCGAATATGTCGACAATCTCAAGTCACGGAGATGTTTGGCTCTCGCCGACAATACC
ACAACGGTCGAAATGGATCCCGGTAGTCGAAACACCTTCGATCTTAGCTACTACCGTCTGGTGCTGAAACGTCGTGGACTTTTCGAGTCTGACGCTGCATTGACTATGAATCCCGCGGCA
TTGGCTCAGGTCAAACGCTTTTCCGGAGGATCGGAGCAAGAGTTCTTTGCTGAGTTCTCGAAGTCCATGGAGAAAATGGGAAGGATTGGGGTCAAAACCGGGTCGGATGGGGAGATCCGG
AGAACATGTGCATTTGTTAATTAG

Retrieve as FASTA